Recombinant Human SMS Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SMS-5827H |
Product Overview : | SMS MS Standard C13 and N15-labeled recombinant protein (NP_004586) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein belonging to the spermidine/spermin synthase family and catalyzes the production of spermine from spermidine. Pseudogenes of this gene are located on chromosomes 1, 5, 6 and X. Mutations in this gene cause an X-linked intellectual disability called Snyder-Robinson Syndrome (SRS). Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 41.3 kDa |
AA Sequence : | MAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAKPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SMS spermine synthase [ Homo sapiens (human) ] |
Official Symbol | SMS |
Synonyms | SMS; spermine synthase; Snyder Robinson X linked mental retardation syndrome, SRS; MRSR; SPMSY; SpS; spermidine aminopropyltransferase; Snyder-Robinson X-linked mental retardation syndrome; SRS; |
Gene ID | 6611 |
mRNA Refseq | NM_004595 |
Protein Refseq | NP_004586 |
MIM | 300105 |
UniProt ID | P52788 |
◆ Recombinant Proteins | ||
Sms-5979M | Recombinant Mouse Sms Protein, Myc/DDK-tagged | +Inquiry |
SMS-15648M | Recombinant Mouse SMS Protein | +Inquiry |
SMS-30399TH | Recombinant Human SMS | +Inquiry |
SMS-2824H | Recombinant Human SMS protein, His-tagged | +Inquiry |
SMS-5827H | Recombinant Human SMS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMS-1651HCL | Recombinant Human SMS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMS Products
Required fields are marked with *
My Review for All SMS Products
Required fields are marked with *
0
Inquiry Basket