Recombinant Human SMS Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SMS-5827H |
| Product Overview : | SMS MS Standard C13 and N15-labeled recombinant protein (NP_004586) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a protein belonging to the spermidine/spermin synthase family and catalyzes the production of spermine from spermidine. Pseudogenes of this gene are located on chromosomes 1, 5, 6 and X. Mutations in this gene cause an X-linked intellectual disability called Snyder-Robinson Syndrome (SRS). Multiple transcript variants encoding different isoforms have been found for this gene. |
| Molecular Mass : | 41.3 kDa |
| AA Sequence : | MAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAKPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SMS spermine synthase [ Homo sapiens (human) ] |
| Official Symbol | SMS |
| Synonyms | SMS; spermine synthase; Snyder Robinson X linked mental retardation syndrome, SRS; MRSR; SPMSY; SpS; spermidine aminopropyltransferase; Snyder-Robinson X-linked mental retardation syndrome; SRS; |
| Gene ID | 6611 |
| mRNA Refseq | NM_004595 |
| Protein Refseq | NP_004586 |
| MIM | 300105 |
| UniProt ID | P52788 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMS Products
Required fields are marked with *
My Review for All SMS Products
Required fields are marked with *
