Recombinant Human SMTN, His-tagged
| Cat.No. : | SMTN-31420TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 707-915 of Human Smoothelin with N terminal His tag; 209 amino acids, 26kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 707-915 a.a. |
| Description : | This gene encodes a structural protein that is found exclusively in contractile smooth muscle cells. It associates with stress fibers and constitutes part of the cytoskeleton. This gene is localized to chromosome 22q12.3, distal to the TUPLE1 locus and outside the DiGeorge syndrome deletion. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 126 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
| Sequences of amino acids : | KTFSSSSSSKKMGSIFDREDQASPRAGSLAALEKRQAEKK KELMKAQSLPKTSASQARKAMIEKLEKEGAAGSPGGPR AAVQRSTSFGVPNANSIKQMLLDWCRAKTRGYEHVDIQNF SSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEV AFSSAETHADCPQLLDTEDMVRLREPDWKCVYTYIQEF YRCLVQKGLVKTKKS |
| Gene Name | SMTN smoothelin [ Homo sapiens ] |
| Official Symbol | SMTN |
| Synonyms | SMTN; smoothelin; |
| Gene ID | 6525 |
| mRNA Refseq | NM_001207017 |
| Protein Refseq | NP_001193946 |
| MIM | 602127 |
| Uniprot ID | P53814 |
| Chromosome Location | 22q12 |
| Function | actin binding; structural constituent of muscle; |
| ◆ Recombinant Proteins | ||
| SMTN-2049H | Recombinant Human SMTN Protein, His (Fc)-Avi-tagged | +Inquiry |
| Smtn-5980M | Recombinant Mouse Smtn Protein, Myc/DDK-tagged | +Inquiry |
| SMTN-31420TH | Recombinant Human SMTN, His-tagged | +Inquiry |
| SMTN-2206H | Recombinant Human SMTN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SMTN-2075HFL | Recombinant Full Length Human SMTN Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SMTN-1650HCL | Recombinant Human SMTN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMTN Products
Required fields are marked with *
My Review for All SMTN Products
Required fields are marked with *
