Recombinant Human SMURF1 protein(198-374aa), His-GST-tagged
Cat.No. : | SMURF1-4167H |
Product Overview : | Recombinant Human SMURF1 protein(Q9HCE7)(198-374aa), fused with N-terminal His and GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 198-374aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 51.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | VESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPSPSGTIPGGDAAFLYEFLLQGHTSEPRDLNSVNCDELGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHIMNHQCQLKEPSQPLPLPSEGSLEDEELPAQRY |
Gene Name | SMURF1 SMAD specific E3 ubiquitin protein ligase 1 [ Homo sapiens ] |
Official Symbol | SMURF1 |
Synonyms | SMURF1; SMAD specific E3 ubiquitin protein ligase 1; E3 ubiquitin-protein ligase SMURF1; KIAA1625; hSMURF1; E3 ubiquitin ligase SMURF1; Smad-specific E3 ubiquitin ligase 1; Smad ubiquitination regulatory factor 1; SMAD-specific E3 ubiquitin-protein ligase 1; |
Gene ID | 57154 |
mRNA Refseq | NM_001199847 |
Protein Refseq | NP_001186776 |
MIM | 605568 |
UniProt ID | Q9HCE7 |
◆ Recombinant Proteins | ||
SMURF1-1344H | Recombinant Human SMURF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Smurf1-5984M | Recombinant Mouse Smurf1 Protein, Myc/DDK-tagged | +Inquiry |
SMURF1-264Z | Recombinant Zebrafish SMURF1 | +Inquiry |
SMURF1-45H | Recombinant Human SMURF1 protein, GST-tagged | +Inquiry |
SMURF1-4167H | Recombinant Human SMURF1 protein(198-374aa), His-GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SMURF1-1647HCL | Recombinant Human SMURF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMURF1 Products
Required fields are marked with *
My Review for All SMURF1 Products
Required fields are marked with *