Recombinant Human SNAI1

Cat.No. : SNAI1-30016TH
Product Overview : Recombinant fragment corresponding to amino acids 121-230 of Human SNAIL with a N terminal proprietary tag; predicted MWt 37.73 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : The Drosophila embryonic protein snail is a zinc finger transcriptional repressor which downregulates the expression of ectodermal genes within the mesoderm. The nuclear protein encoded by this gene is structurally similar to the Drosophila snail protein, and is also thought to be critical for mesoderm formation in the developing embryo. At least two variants of a similar processed pseudogene have been found on chromosome 2.
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Expressed in a variety of tissues with the highest expression in kidney. Expressed in mesenchymal and epithelial cell lines.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCN KEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVR THTGEKPFSCPHCSRAFADRSNLRAHLQTH
Sequence Similarities : Belongs to the snail C2H2-type zinc-finger protein family.Contains 4 C2H2-type zinc fingers.
Gene Name SNAI1 snail homolog 1 (Drosophila) [ Homo sapiens ]
Official Symbol SNAI1
Synonyms SNAI1; snail homolog 1 (Drosophila); snail 1 (drosophila homolog), zinc finger protein; zinc finger protein SNAI1; SLUGH2; SNA; SNAH; SNAIL; SNAIL1;
Gene ID 6615
mRNA Refseq NM_005985
Protein Refseq NP_005976
MIM 604238
Uniprot ID O95863
Chromosome Location 20q13.2
Pathway Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met), organism-specific biosystem; Validated targets of C-MYC transcriptional activation, organism-specific biosystem;
Function kinase binding; metal ion binding; protein binding; sequence-specific DNA binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNAI1 Products

Required fields are marked with *

My Review for All SNAI1 Products

Required fields are marked with *

0
cart-icon