Recombinant Human SNAI2 protein, GST-tagged
| Cat.No. : | SNAI2-2829H |
| Product Overview : | Recombinant Human SNAI2 protein(1-268 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-268 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH |
| Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SNAI2 snail homolog 2 (Drosophila) [ Homo sapiens ] |
| Official Symbol | SNAI2 |
| Synonyms | SNAI2; snail homolog 2 (Drosophila); SLUG, slug homolog, zinc finger protein (chicken); zinc finger protein SNAI2; SLUGH1; SNAIL2; protein snail homolog 2; neural crest transcription factor SLUG; slug (chicken homolog), zinc finger protein; SLUG; WS2D; MGC10182; |
| Gene ID | 6591 |
| mRNA Refseq | NM_003068 |
| Protein Refseq | NP_003059 |
| MIM | 602150 |
| UniProt ID | O43623 |
| ◆ Recombinant Proteins | ||
| SNAI2-15661M | Recombinant Mouse SNAI2 Protein | +Inquiry |
| SNAI2-4355R | Recombinant Rhesus monkey SNAI2 Protein, His-tagged | +Inquiry |
| SNAI2-4171R | Recombinant Rhesus Macaque SNAI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SNAI2-5290R | Recombinant Rat SNAI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SNAI2-290H | Recombinant Human SNAI2, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNAI2-1642HCL | Recombinant Human SNAI2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNAI2 Products
Required fields are marked with *
My Review for All SNAI2 Products
Required fields are marked with *
