Recombinant Human SNAI3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SNAI3-4218H |
Product Overview : | SNAI3 MS Standard C13 and N15-labeled recombinant protein (NP_840101) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | SNAI3 is a member of the SNAIL gene family, named for the Drosophila snail gene, which plays roles in mesodermal formation during embryogenesis. |
Molecular Mass : | 32.3 kDa |
AA Sequence : | MPRSFLVKTHSSHRVPNYRRLETQREINGACSACGGLVVPLLPRDKEAPSVPGDLPQPWDRSSAVACISLPLLPRIEEALGASGLDALEVSEVDPRASRAAIVPLKDSLNHLNLPPLLVLPTRWSPTLGPDRHGAPEKLLGAERMPRAPGGFECFHCHKPYHTLAGLARHRQLHCHLQVGRVFTCKYCDKEYTSLGALKMHIRTHTLPCTCKICGKAFSRPWLLQGHVRTHTGEKPYACSHCSRAFADRSNLRAHLQTHSDAKKYRCRRCTKTFSRMSLLARHEESGCCPGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SNAI3 snail family transcriptional repressor 3 [ Homo sapiens (human) ] |
Official Symbol | SNAI3 |
Synonyms | SNAI3; snail homolog 3 (Drosophila); SMUC; SNAIL3; ZNF293; Zfp293; zinc finger protein SNAI3; protein snail homolog 3; snail family zinc finger 3; snail homolog 3; zinc finger protein 293 |
Gene ID | 333929 |
mRNA Refseq | NM_178310 |
Protein Refseq | NP_840101 |
MIM | 612741 |
UniProt ID | Q3KNW1 |
◆ Recombinant Proteins | ||
SNAI3-4218H | Recombinant Human SNAI3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SNAI3-4717Z | Recombinant Zebrafish SNAI3 | +Inquiry |
SNAI3-2830H | Recombinant Human SNAI3, His-tagged | +Inquiry |
SNAI3-4172R | Recombinant Rhesus Macaque SNAI3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Snai3-5990M | Recombinant Mouse Snai3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNAI3-615HCL | Recombinant Human SNAI3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNAI3 Products
Required fields are marked with *
My Review for All SNAI3 Products
Required fields are marked with *