Recombinant Human SNAI3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SNAI3-4218H
Product Overview : SNAI3 MS Standard C13 and N15-labeled recombinant protein (NP_840101) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SNAI3 is a member of the SNAIL gene family, named for the Drosophila snail gene, which plays roles in mesodermal formation during embryogenesis.
Molecular Mass : 32.3 kDa
AA Sequence : MPRSFLVKTHSSHRVPNYRRLETQREINGACSACGGLVVPLLPRDKEAPSVPGDLPQPWDRSSAVACISLPLLPRIEEALGASGLDALEVSEVDPRASRAAIVPLKDSLNHLNLPPLLVLPTRWSPTLGPDRHGAPEKLLGAERMPRAPGGFECFHCHKPYHTLAGLARHRQLHCHLQVGRVFTCKYCDKEYTSLGALKMHIRTHTLPCTCKICGKAFSRPWLLQGHVRTHTGEKPYACSHCSRAFADRSNLRAHLQTHSDAKKYRCRRCTKTFSRMSLLARHEESGCCPGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SNAI3 snail family transcriptional repressor 3 [ Homo sapiens (human) ]
Official Symbol SNAI3
Synonyms SNAI3; snail homolog 3 (Drosophila); SMUC; SNAIL3; ZNF293; Zfp293; zinc finger protein SNAI3; protein snail homolog 3; snail family zinc finger 3; snail homolog 3; zinc finger protein 293
Gene ID 333929
mRNA Refseq NM_178310
Protein Refseq NP_840101
MIM 612741
UniProt ID Q3KNW1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNAI3 Products

Required fields are marked with *

My Review for All SNAI3 Products

Required fields are marked with *

0
cart-icon
0
compare icon