Recombinant Human SNAI3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SNAI3-4218H
• Product Overview: SNAI3 MS Standard C13 and N15-labeled recombinant protein (NP_840101) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: SNAI3 is a member of the SNAIL gene family, named for the Drosophila snail gene, which plays roles in mesodermal formation during embryogenesis.
• Molecular Mass: 32.3 kDa
• AA Sequence: MPRSFLVKTHSSHRVPNYRRLETQREINGACSACGGLVVPLLPRDKEAPSVPGDLPQPWDRSSAVACISLPLLPRIEEALGASGLDALEVSEVDPRASRAAIVPLKDSLNHLNLPPLLVLPTRWSPTLGPDRHGAPEKLLGAERMPRAPGGFECFHCHKPYHTLAGLARHRQLHCHLQVGRVFTCKYCDKEYTSLGALKMHIRTHTLPCTCKICGKAFSRPWLLQGHVRTHTGEKPYACSHCSRAFADRSNLRAHLQTHSDAKKYRCRRCTKTFSRMSLLARHEESGCCPGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SNAI3 snail family transcriptional repressor 3 [ Homo sapiens (human) ]
• Official Symbol: SNAI3
• Synonyms: SNAI3; snail homolog 3 (Drosophila); SMUC; SNAIL3; ZNF293; Zfp293; zinc finger protein SNAI3; protein snail homolog 3; snail family zinc finger 3; snail homolog 3; zinc finger protein 293
• Gene ID: 333929
• mRNA Refseq: NM_178310
• Protein Refseq: NP_840101
• MIM: 612741
• UniProt ID: Q3KNW1