Recombinant Human SNAP29 protein, His-tagged
| Cat.No. : | SNAP29-2887H |
| Product Overview : | Recombinant Human SNAP29 protein(1-258 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | December 14, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-258 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SNAP29 synaptosomal-associated protein, 29kDa [ Homo sapiens ] |
| Official Symbol | SNAP29 |
| Synonyms | SNAP29; synaptosomal-associated protein, 29kDa; synaptosomal associated protein, 29kD; synaptosomal-associated protein 29; CEDNIK; SNAP 29; soluble 29 kDa NSF attachment protein; vesicle-membrane fusion protein SNAP-29; SNAP-29; FLJ21051; |
| Gene ID | 9342 |
| mRNA Refseq | NM_004782 |
| Protein Refseq | NP_004773 |
| MIM | 604202 |
| UniProt ID | O95721 |
| ◆ Recombinant Proteins | ||
| SNAP29-15665M | Recombinant Mouse SNAP29 Protein | +Inquiry |
| SNAP29-8516M | Recombinant Mouse SNAP29 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SNAP29-6403H | Recombinant Human SNAP29 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SNAP29-8146Z | Recombinant Zebrafish SNAP29 | +Inquiry |
| SNAP29-2887H | Recombinant Human SNAP29 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNAP29-1652HCL | Recombinant Human SNAP29 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNAP29 Products
Required fields are marked with *
My Review for All SNAP29 Products
Required fields are marked with *
