Recombinant Human SNAP29 protein, His-tagged

• Cat.No.: SNAP29-2887H
• Product Overview: Recombinant Human SNAP29 protein(1-258 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-258 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: SNAP29 synaptosomal-associated protein, 29kDa [ Homo sapiens ]
• Official Symbol: SNAP29
• Synonyms: SNAP29; synaptosomal-associated protein, 29kDa; synaptosomal associated protein, 29kD; synaptosomal-associated protein 29; CEDNIK; SNAP 29; soluble 29 kDa NSF attachment protein; vesicle-membrane fusion protein SNAP-29; SNAP-29; FLJ21051
• Gene ID: 9342
• mRNA Refseq: NM_004782
• Protein Refseq: NP_004773
• MIM: 604202
• UniProt ID: O95721