Recombinant Human SNAP29 protein, His-tagged
Cat.No. : | SNAP29-2887H |
Product Overview : | Recombinant Human SNAP29 protein(1-258 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-258 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SNAP29 synaptosomal-associated protein, 29kDa [ Homo sapiens ] |
Official Symbol | SNAP29 |
Synonyms | SNAP29; synaptosomal-associated protein, 29kDa; synaptosomal associated protein, 29kD; synaptosomal-associated protein 29; CEDNIK; SNAP 29; soluble 29 kDa NSF attachment protein; vesicle-membrane fusion protein SNAP-29; SNAP-29; FLJ21051; |
Gene ID | 9342 |
mRNA Refseq | NM_004782 |
Protein Refseq | NP_004773 |
MIM | 604202 |
UniProt ID | O95721 |
◆ Recombinant Proteins | ||
SNAP29-2833H | Recombinant Human SNAP29, GST-tagged | +Inquiry |
SNAP29-15665M | Recombinant Mouse SNAP29 Protein | +Inquiry |
SNAP29-2060H | Recombinant Human SNAP29 Protein, MYC/DDK-tagged | +Inquiry |
SNAP29-4175R | Recombinant Rhesus Macaque SNAP29 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNAP29-2358C | Recombinant Chicken SNAP29 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNAP29-1652HCL | Recombinant Human SNAP29 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNAP29 Products
Required fields are marked with *
My Review for All SNAP29 Products
Required fields are marked with *
0
Inquiry Basket