Recombinant Human SNCA Protein
Cat.No. : | SNCA-385H |
Product Overview : | Recombinant Human SNCA(1-140 aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 1-140 aa |
Description : | SNCA is associated with human neurodegenerative diseases, where it forms aggregates in nerve tissues. Diseases include Parkinson’s disease, dementia with lewy bodies, and multi-system atrophy, but also other’s disease like Alzheimer’s Disease. Lewy Bodies are well-known cytoplasmic deposits of SNCA in Parkinson’s disease. |
Form : | Finally dialysed in pure water, shock frozen in liquid nitrogen at a protein concentration of 2.5 mg/ml |
Molecular Mass : | 14604 kg/mol |
AA Sequence : | GSMDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
Purity : | > 98% by SDS-PAGE |
Notes : | Thawing: Gentle agitation at 37 centigrade. Refreezing is not recommended and should be avoided. |
Storage : | Store at -80 centigrade |
Concentration : | 2.5 mg/ml |
Gene Name | SNCA synuclein, alpha (non A4 component of amyloid precursor) [ Homo sapiens ] |
Official Symbol | SNCA |
Synonyms | SNCA; synuclein, alpha (non A4 component of amyloid precursor); PARK1, PARK4, Parkinson disease (autosomal dominant, Lewy body) 4; alpha-synuclein; alpha synuclein; NACP; PD1; synuclein alpha-140; non A-beta component of AD amyloid; PARK1; PARK4; MGC110988; |
Gene ID | 6622 |
mRNA Refseq | NM_000345 |
Protein Refseq | NP_000336 |
MIM | 163890 |
UniProt ID | P37840 |
◆ Recombinant Proteins | ||
Snca-2730M | Recombinant Mouse Synuclein, Alpha | +Inquiry |
SNCA-240H | Active Recombinant Human SNCA protein | +Inquiry |
SNCA-2837H | Recombinant Human SNCA, GST-tagged | +Inquiry |
SNCA-292H | Recombinant Human Synuclein, Alpha (Non A4 Component of Amyloid Precursor), 96-140 | +Inquiry |
SNCA-2875H | Recombinant Human SNCA protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
SNCA-27342TH | Native Human SNCA | +Inquiry |
SNCA-27345TH | Native Human SNCA | +Inquiry |
SNCA-27339TH | Native Human SNCA | +Inquiry |
SNCA-27341TH | Native Human SNCA | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNCA-1634HCL | Recombinant Human SNCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNCA Products
Required fields are marked with *
My Review for All SNCA Products
Required fields are marked with *