Recombinant Human SNCA Protein
| Cat.No. : | SNCA-385H |
| Product Overview : | Recombinant Human SNCA(1-140 aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 1-140 aa |
| Description : | SNCA is associated with human neurodegenerative diseases, where it forms aggregates in nerve tissues. Diseases include Parkinson’s disease, dementia with lewy bodies, and multi-system atrophy, but also other’s disease like Alzheimer’s Disease. Lewy Bodies are well-known cytoplasmic deposits of SNCA in Parkinson’s disease. |
| Form : | Finally dialysed in pure water, shock frozen in liquid nitrogen at a protein concentration of 2.5 mg/ml |
| Molecular Mass : | 14604 kg/mol |
| AA Sequence : | GSMDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
| Purity : | > 98% by SDS-PAGE |
| Notes : | Thawing: Gentle agitation at 37 centigrade. Refreezing is not recommended and should be avoided. |
| Storage : | Store at -80 centigrade |
| Concentration : | 2.5 mg/ml |
| Gene Name | SNCA synuclein, alpha (non A4 component of amyloid precursor) [ Homo sapiens ] |
| Official Symbol | SNCA |
| Synonyms | SNCA; synuclein, alpha (non A4 component of amyloid precursor); PARK1, PARK4, Parkinson disease (autosomal dominant, Lewy body) 4; alpha-synuclein; alpha synuclein; NACP; PD1; synuclein alpha-140; non A-beta component of AD amyloid; PARK1; PARK4; MGC110988; |
| Gene ID | 6622 |
| mRNA Refseq | NM_000345 |
| Protein Refseq | NP_000336 |
| MIM | 163890 |
| UniProt ID | P37840 |
| ◆ Recombinant Proteins | ||
| SNCA-3392L | Recombinant Lagothrix lagotricha (Common woolly monkey) SNCA, His-tagged | +Inquiry |
| SNCA-290H | Recombinant Human Synuclein, Alpha (Non A4 Component of Amyloid Precursor), A30P/A53T | +Inquiry |
| SNCA-245H | Recombinant Human SNCA, His-tagged | +Inquiry |
| SNCA-27348TH | Recombinant Human SNCA | +Inquiry |
| Snca-1890C | Active Recombinant Cynomolgus Snca protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| SNCA-27339TH | Native Human SNCA | +Inquiry |
| SNCA-27345TH | Native Human SNCA | +Inquiry |
| SNCA-27342TH | Native Human SNCA | +Inquiry |
| SNCA-27341TH | Native Human SNCA | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNCA-1634HCL | Recombinant Human SNCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNCA Products
Required fields are marked with *
My Review for All SNCA Products
Required fields are marked with *




