Recombinant Human SNCA Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SNCA-6456H |
| Product Overview : | SNCA MS Standard C13 and N15-labeled recombinant protein (NP_000336) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. |
| Molecular Mass : | 14.3 kDa |
| AA Sequence : | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SNCA synuclein alpha [ Homo sapiens (human) ] |
| Official Symbol | SNCA |
| Synonyms | SNCA; synuclein, alpha (non A4 component of amyloid precursor); PARK1, PARK4, Parkinson disease (autosomal dominant, Lewy body) 4; alpha-synuclein; alpha synuclein; NACP; PD1; synuclein alpha-140; non A-beta component of AD amyloid; PARK1; PARK4; MGC110988; |
| Gene ID | 6622 |
| mRNA Refseq | NM_000345 |
| Protein Refseq | NP_000336 |
| MIM | 163890 |
| UniProt ID | P37840 |
| ◆ Recombinant Proteins | ||
| SNCA-5522H | Recombinant Human SNCA protein, His-tagged | +Inquiry |
| SNCA-3395S | Recombinant Saguinus labiatus (Red-chested mustached tamarin) SNCA, His-tagged | +Inquiry |
| SNCA-385H | Recombinant Human SNCA Protein | +Inquiry |
| SNCA-5970H | Recombinant Human SNCA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SNCA-2874H | Active Recombinant Human SNCA protein, Fc-tagged | +Inquiry |
| ◆ Native Proteins | ||
| SNCA-27341TH | Native Human SNCA | +Inquiry |
| SNCA-27339TH | Native Human SNCA | +Inquiry |
| SNCA-27342TH | Native Human SNCA | +Inquiry |
| SNCA-27345TH | Native Human SNCA | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNCA-1634HCL | Recombinant Human SNCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNCA Products
Required fields are marked with *
My Review for All SNCA Products
Required fields are marked with *



