Recombinant Human SNN protein, GST-tagged
Cat.No. : | SNN-2844H |
Product Overview : | Recombinant Human SNN protein(1-88 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | August 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-88 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTPNGPEVHG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SNN stannin [ Homo sapiens ] |
Official Symbol | SNN |
Gene ID | 8303 |
mRNA Refseq | NM_003498.5 |
Protein Refseq | NP_003489.1 |
MIM | 603032 |
UniProt ID | O75324 |
◆ Recombinant Proteins | ||
SNN-15681M | Recombinant Mouse SNN Protein | +Inquiry |
SNN-5303R | Recombinant Rat SNN Protein, His (Fc)-Avi-tagged | +Inquiry |
SNN-12281Z | Recombinant Zebrafish SNN | +Inquiry |
RFL17149RF | Recombinant Full Length Rat Stannin(Snn) Protein, His-Tagged | +Inquiry |
RFL7809MF | Recombinant Full Length Mouse Stannin(Snn) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNN Products
Required fields are marked with *
My Review for All SNN Products
Required fields are marked with *