Recombinant Human SNRPA protein(111-190 aa), C-His-tagged
Cat.No. : | SNRPA-2607H |
Product Overview : | Recombinant Human SNRPA protein(P09012)(111-190 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 111-190 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 11 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | RKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQL |
Gene Name | SNRPA small nuclear ribonucleoprotein polypeptide A [ Homo sapiens ] |
Official Symbol | SNRPA |
Synonyms | SNRPA; small nuclear ribonucleoprotein polypeptide A; U1 small nuclear ribonucleoprotein A; Mud1; U1 A; U1A; U1 snRNP A; U1 snRNP-specific protein A; U1 small nuclear RNP-specific A; U1-A; |
Gene ID | 6626 |
mRNA Refseq | NM_004596 |
Protein Refseq | NP_004587 |
MIM | 182285 |
UniProt ID | P09012 |
◆ Recombinant Proteins | ||
SNRPA-4375R | Recombinant Rhesus monkey SNRPA Protein, His-tagged | +Inquiry |
SNRPA-10070Z | Recombinant Zebrafish SNRPA | +Inquiry |
SNRPA1-951C | Recombinant Cynomolgus SNRPA1 Protein, His-tagged | +Inquiry |
Snrpa-6004M | Recombinant Mouse Snrpa Protein, Myc/DDK-tagged | +Inquiry |
SNRPA1-694C | Recombinant Cynomolgus Monkey SNRPA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNRPA-1619HCL | Recombinant Human SNRPA 293 Cell Lysate | +Inquiry |
SNRPA1-1618HCL | Recombinant Human SNRPA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNRPA1 Products
Required fields are marked with *
My Review for All SNRPA1 Products
Required fields are marked with *