Recombinant Human SNRPA protein(111-190 aa), C-His-tagged

Cat.No. : SNRPA-2607H
Product Overview : Recombinant Human SNRPA protein(P09012)(111-190 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 111-190 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 11 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : RKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQL
Gene Name SNRPA small nuclear ribonucleoprotein polypeptide A [ Homo sapiens ]
Official Symbol SNRPA
Synonyms SNRPA; small nuclear ribonucleoprotein polypeptide A; U1 small nuclear ribonucleoprotein A; Mud1; U1 A; U1A; U1 snRNP A; U1 snRNP-specific protein A; U1 small nuclear RNP-specific A; U1-A;
Gene ID 6626
mRNA Refseq NM_004596
Protein Refseq NP_004587
MIM 182285
UniProt ID P09012

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNRPA1 Products

Required fields are marked with *

My Review for All SNRPA1 Products

Required fields are marked with *

0
cart-icon
0
compare icon