Recombinant Human SNRPA protein(111-190 aa), C-His-tagged

• Cat.No.: SNRPA-2607H
• Product Overview: Recombinant Human SNRPA protein(P09012)(111-190 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 111-190 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 11 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: RKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQL

Gene Information

• Gene Name: SNRPA small nuclear ribonucleoprotein polypeptide A [ Homo sapiens ]
• Official Symbol: SNRPA
• Synonyms: SNRPA; small nuclear ribonucleoprotein polypeptide A; U1 small nuclear ribonucleoprotein A; Mud1; U1 A; U1A; U1 snRNP A; U1 snRNP-specific protein A; U1 small nuclear RNP-specific A; U1-A
• Gene ID: 6626
• mRNA Refseq: NM_004596
• Protein Refseq: NP_004587
• MIM: 182285
• UniProt ID: P09012