Recombinant Human SNRPA protein(111-190 aa), C-His-tagged
| Cat.No. : | SNRPA-2607H |
| Product Overview : | Recombinant Human SNRPA protein(P09012)(111-190 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 111-190 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 11 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | RKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQL |
| Gene Name | SNRPA small nuclear ribonucleoprotein polypeptide A [ Homo sapiens ] |
| Official Symbol | SNRPA |
| Synonyms | SNRPA; small nuclear ribonucleoprotein polypeptide A; U1 small nuclear ribonucleoprotein A; Mud1; U1 A; U1A; U1 snRNP A; U1 snRNP-specific protein A; U1 small nuclear RNP-specific A; U1-A; |
| Gene ID | 6626 |
| mRNA Refseq | NM_004596 |
| Protein Refseq | NP_004587 |
| MIM | 182285 |
| UniProt ID | P09012 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNRPA1 Products
Required fields are marked with *
My Review for All SNRPA1 Products
Required fields are marked with *



