Recombinant Human SNRPA1, His-tagged
| Cat.No. : | SNRPA1-29599TH |
| Product Overview : | Recombinant full length Human SNRPA1 with N terminal His tag; 275 amino acids with tag, Predicted MWt 30.5 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 255 amino acids |
| Description : | SNRPA1, also known as U2 small nuclear ribonucleoprotein A, is a component of the U2 snRNP that forms a complex with U2 snRNP B (U2B). Together, U2 snRNP A and U2 snRNP B form a complex that binds to the U2 snRNA hairpin IV. |
| Conjugation : | HIS |
| Molecular Weight : | 30.500kDa inclusive of tags |
| Form : | Liquid |
| Purity : | by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 30% Glycerol, 1.17% Sodium chloride, 0.03% DTT, 0.002% PMSF |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMVKLTAELIEQAAQYTNAVR DRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGF PLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSL VELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVP QVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKT FNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERL KGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS |
| Sequence Similarities : | Belongs to the U2 small nuclear ribonucleoprotein A family.Contains 4 LRR (leucine-rich) repeats.Contains 1 LRRCT domain. |
| Gene Name | SNRPA1 small nuclear ribonucleoprotein polypeptide A [ Homo sapiens ] |
| Official Symbol | SNRPA1 |
| Synonyms | SNRPA1; small nuclear ribonucleoprotein polypeptide A; U2 small nuclear ribonucleoprotein A; Lea1; |
| Gene ID | 6627 |
| mRNA Refseq | NM_003090 |
| Protein Refseq | NP_003081 |
| MIM | 603521 |
| Uniprot ID | P09661 |
| Chromosome Location | 15q26.3 |
| Pathway | Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; |
| Function | RNA binding; protein binding; |
| ◆ Recombinant Proteins | ||
| SNRPA-684HFL | Recombinant Full Length Human SNRPA Protein, C-Flag-tagged | +Inquiry |
| SNRPA1-694C | Recombinant Cynomolgus Monkey SNRPA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SNRPA-2778H | Recombinant Human SNRPA protein, His-tagged | +Inquiry |
| Snrpa-643M | Recombinant Mouse Snrpa protein(1-287aa), His&Myc-tagged | +Inquiry |
| SNRPA1-4192R | Recombinant Rhesus Macaque SNRPA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNRPA1-1618HCL | Recombinant Human SNRPA1 293 Cell Lysate | +Inquiry |
| SNRPA-1619HCL | Recombinant Human SNRPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNRPA1 Products
Required fields are marked with *
My Review for All SNRPA1 Products
Required fields are marked with *
