Recombinant Human SNRPA1, His-tagged
Cat.No. : | SNRPA1-29599TH |
Product Overview : | Recombinant full length Human SNRPA1 with N terminal His tag; 275 amino acids with tag, Predicted MWt 30.5 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 255 amino acids |
Description : | SNRPA1, also known as U2 small nuclear ribonucleoprotein A, is a component of the U2 snRNP that forms a complex with U2 snRNP B (U2B). Together, U2 snRNP A and U2 snRNP B form a complex that binds to the U2 snRNA hairpin IV. |
Conjugation : | HIS |
Molecular Weight : | 30.500kDa inclusive of tags |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 30% Glycerol, 1.17% Sodium chloride, 0.03% DTT, 0.002% PMSF |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMVKLTAELIEQAAQYTNAVR DRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGF PLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSL VELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVP QVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKT FNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERL KGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS |
Sequence Similarities : | Belongs to the U2 small nuclear ribonucleoprotein A family.Contains 4 LRR (leucine-rich) repeats.Contains 1 LRRCT domain. |
Gene Name | SNRPA1 small nuclear ribonucleoprotein polypeptide A [ Homo sapiens ] |
Official Symbol | SNRPA1 |
Synonyms | SNRPA1; small nuclear ribonucleoprotein polypeptide A; U2 small nuclear ribonucleoprotein A; Lea1; |
Gene ID | 6627 |
mRNA Refseq | NM_003090 |
Protein Refseq | NP_003081 |
MIM | 603521 |
Uniprot ID | P09661 |
Chromosome Location | 15q26.3 |
Pathway | Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; |
Function | RNA binding; protein binding; |
◆ Recombinant Proteins | ||
SNRPA1-951C | Recombinant Cynomolgus SNRPA1 Protein, His-tagged | +Inquiry |
SNRPA-684HFL | Recombinant Full Length Human SNRPA Protein, C-Flag-tagged | +Inquiry |
SNRPA1-1769Z | Recombinant Zebrafish SNRPA1 | +Inquiry |
SNRPA-2060H | Recombinant Human SNRPA Protein, His (Fc)-Avi-tagged | +Inquiry |
SNRPA-4375R | Recombinant Rhesus monkey SNRPA Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNRPA-1619HCL | Recombinant Human SNRPA 293 Cell Lysate | +Inquiry |
SNRPA1-1618HCL | Recombinant Human SNRPA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNRPA1 Products
Required fields are marked with *
My Review for All SNRPA1 Products
Required fields are marked with *