Recombinant Human SNRPC
| Cat.No. : | SNRPC-30583TH |
| Product Overview : | Recombinant full length Human SNRPC with N-terminal proprietary tag. Predicted MW 43.56kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 159 amino acids |
| Description : | This gene encodes one of the specific protein components of the U1 small nuclear ribonucleoprotein (snRNP) particle required for the formation of the spliceosome. The encoded protein participates in the processing of nuclear precursor messenger RNA splicing. snRNP particles are attacked by autoantibodies frequently produced by patients with connective tissue diseases. The genome contains several pseudogenes of this functional gene. Alternative splicing results in a non-coding transcript variant. |
| Molecular Weight : | 43.560kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQK WMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPP PSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAP GMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR |
| Sequence Similarities : | Belongs to the U1 small nuclear ribonucleoprotein C family.Contains 1 matrin-type zinc finger. |
| Gene Name | SNRPC small nuclear ribonucleoprotein polypeptide C [ Homo sapiens ] |
| Official Symbol | SNRPC |
| Synonyms | SNRPC; small nuclear ribonucleoprotein polypeptide C; U1 small nuclear ribonucleoprotein C; U1 C; Yhc1; |
| Gene ID | 6631 |
| mRNA Refseq | NM_003093 |
| Protein Refseq | NP_003084 |
| MIM | 603522 |
| Uniprot ID | P09234 |
| Chromosome Location | 6p21 |
| Pathway | Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, U1-snRNP, organism-specific biosystem; |
| Function | RNA binding; NOT U1 snRNA binding; metal ion binding; nucleic acid binding; protein binding; |
| ◆ Recombinant Proteins | ||
| SNRPC-6329H | Recombinant Human SNRPC Protein (Met1-Arg159), N-His tagged | +Inquiry |
| SNRPC-486HF | Recombinant Full Length Human SNRPC Protein | +Inquiry |
| SNRPC-5534C | Recombinant Chicken SNRPC | +Inquiry |
| SNRPC-1323H | Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide C, His-tagged | +Inquiry |
| SNRPC-5648R | Recombinant Rat SNRPC Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNRPC-616HCL | Recombinant Human SNRPC lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNRPC Products
Required fields are marked with *
My Review for All SNRPC Products
Required fields are marked with *
