Recombinant Human SNRPC

Cat.No. : SNRPC-30583TH
Product Overview : Recombinant full length Human SNRPC with N-terminal proprietary tag. Predicted MW 43.56kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 159 amino acids
Description : This gene encodes one of the specific protein components of the U1 small nuclear ribonucleoprotein (snRNP) particle required for the formation of the spliceosome. The encoded protein participates in the processing of nuclear precursor messenger RNA splicing. snRNP particles are attacked by autoantibodies frequently produced by patients with connective tissue diseases. The genome contains several pseudogenes of this functional gene. Alternative splicing results in a non-coding transcript variant.
Molecular Weight : 43.560kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQK WMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPP PSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAP GMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR
Sequence Similarities : Belongs to the U1 small nuclear ribonucleoprotein C family.Contains 1 matrin-type zinc finger.
Gene Name SNRPC small nuclear ribonucleoprotein polypeptide C [ Homo sapiens ]
Official Symbol SNRPC
Synonyms SNRPC; small nuclear ribonucleoprotein polypeptide C; U1 small nuclear ribonucleoprotein C; U1 C; Yhc1;
Gene ID 6631
mRNA Refseq NM_003093
Protein Refseq NP_003084
MIM 603522
Uniprot ID P09234
Chromosome Location 6p21
Pathway Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, U1-snRNP, organism-specific biosystem;
Function RNA binding; NOT U1 snRNA binding; metal ion binding; nucleic acid binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNRPC Products

Required fields are marked with *

My Review for All SNRPC Products

Required fields are marked with *

0
cart-icon
0
compare icon