Recombinant Human SNRPD2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SNRPD2-4877H |
Product Overview : | SNRPD2 MS Standard C13 and N15-labeled recombinant protein (NP_004588) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 13.5 kDa |
AA Sequence : | MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SNRPD2 small nuclear ribonucleoprotein D2 polypeptide 16.5kDa [ Homo sapiens (human) ] |
Official Symbol | SNRPD2 |
Synonyms | SNRPD2; small nuclear ribonucleoprotein D2 polypeptide 16.5kDa; small nuclear ribonucleoprotein D2 polypeptide (16.5kD), SNRPD1; small nuclear ribonucleoprotein Sm D2; Sm D2; snRNP core protein D2; SMD2; Sm-D2; SNRPD1; |
Gene ID | 6633 |
mRNA Refseq | NM_004597 |
Protein Refseq | NP_004588 |
MIM | 601061 |
UniProt ID | P62316 |
◆ Recombinant Proteins | ||
SNRPD2-4196R | Recombinant Rhesus Macaque SNRPD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNRPD2-2712H | Recombinant Human SNRPD2 Protein, His-tagged | +Inquiry |
SNRPD2-15696M | Recombinant Mouse SNRPD2 Protein | +Inquiry |
SNRPD2-5188H | Recombinant Human SNRPD2 protein, GST-tagged | +Inquiry |
SNRPD2-3412H | Recombinant Human SNRPD2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNRPD2-1614HCL | Recombinant Human SNRPD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNRPD2 Products
Required fields are marked with *
My Review for All SNRPD2 Products
Required fields are marked with *