Recombinant Human SNRPD2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SNRPD2-4877H
• Product Overview: SNRPD2 MS Standard C13 and N15-labeled recombinant protein (NP_004588) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 13.5 kDa
• AA Sequence: MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SNRPD2 small nuclear ribonucleoprotein D2 polypeptide 16.5kDa [ Homo sapiens (human) ]
• Official Symbol: SNRPD2
• Synonyms: SNRPD2; small nuclear ribonucleoprotein D2 polypeptide 16.5kDa; small nuclear ribonucleoprotein D2 polypeptide (16.5kD), SNRPD1; small nuclear ribonucleoprotein Sm D2; Sm D2; snRNP core protein D2; SMD2; Sm-D2; SNRPD1
• Gene ID: 6633
• mRNA Refseq: NM_004597
• Protein Refseq: NP_004588
• MIM: 601061
• UniProt ID: P62316