Recombinant Human SNRPE protein, GST-tagged
| Cat.No. : | SNRPE-2850H |
| Product Overview : | Recombinant Human SNRPE protein(1-92 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-92 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SNRPE small nuclear ribonucleoprotein polypeptide E [ Homo sapiens ] |
| Official Symbol | SNRPE |
| Synonyms | SNRPE; small nuclear ribonucleoprotein polypeptide E; small nuclear ribonucleoprotein E; Sm E; snRNP-E; sm protein E; SME; Sm-E; B-raf; |
| Gene ID | 6635 |
| mRNA Refseq | NM_003094 |
| Protein Refseq | NP_003085 |
| MIM | 128260 |
| UniProt ID | P62304 |
| ◆ Recombinant Proteins | ||
| Snrpe-6007M | Recombinant Mouse Snrpe Protein, Myc/DDK-tagged | +Inquiry |
| SNRPE-4198R | Recombinant Rhesus Macaque SNRPE Protein, His (Fc)-Avi-tagged | +Inquiry |
| SNRPE-11237Z | Recombinant Zebrafish SNRPE | +Inquiry |
| SNRPE-15698M | Recombinant Mouse SNRPE Protein | +Inquiry |
| SNRPE-2714H | Recombinant Human SNRPE Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNRPE-1613HCL | Recombinant Human SNRPE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNRPE Products
Required fields are marked with *
My Review for All SNRPE Products
Required fields are marked with *
