Recombinant Human SNRPE protein, GST-tagged
Cat.No. : | SNRPE-2850H |
Product Overview : | Recombinant Human SNRPE protein(1-92 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | August 27, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-92 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SNRPE small nuclear ribonucleoprotein polypeptide E [ Homo sapiens ] |
Official Symbol | SNRPE |
Synonyms | SNRPE; small nuclear ribonucleoprotein polypeptide E; small nuclear ribonucleoprotein E; Sm E; snRNP-E; sm protein E; SME; Sm-E; B-raf; |
Gene ID | 6635 |
mRNA Refseq | NM_003094 |
Protein Refseq | NP_003085 |
MIM | 128260 |
UniProt ID | P62304 |
◆ Recombinant Proteins | ||
SNRPE-3687H | Recombinant Human SNRPE Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SNRPE-4382R | Recombinant Rhesus monkey SNRPE Protein, His-tagged | +Inquiry |
SNRPE-30584TH | Recombinant Human SNRPE, His-tagged | +Inquiry |
SNRPE-2714H | Recombinant Human SNRPE Protein, His-tagged | +Inquiry |
SNRPE-8539M | Recombinant Mouse SNRPE Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNRPE-1613HCL | Recombinant Human SNRPE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNRPE Products
Required fields are marked with *
My Review for All SNRPE Products
Required fields are marked with *