Recombinant Human SNRPF
Cat.No. : | SNRPF-30586TH |
Product Overview : | Recombinant full length Human SNRPF expressed in Saccharomyces cerevisiae; amino acids 1-86 ; 9.7kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 1-86 a.a. |
Description : | Small nuclear ribonucleoprotein polypeptide F, also known SNRPF, belongs to the snRNP Sm proteins family. There are at least seven isoforms, E, F, G, D1, D2, D3 and B/B. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYM NMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEE EEDGEMRE |
Full Length : | Full L. |
Gene Name | SNRPF small nuclear ribonucleoprotein polypeptide F [ Homo sapiens ] |
Official Symbol | SNRPF |
Synonyms | SNRPF; small nuclear ribonucleoprotein polypeptide F; small nuclear ribonucleoprotein F; Sm F; |
Gene ID | 6636 |
mRNA Refseq | NM_003095 |
Protein Refseq | NP_003086 |
MIM | 603541 |
Uniprot ID | P62306 |
Chromosome Location | 12q23.1 |
Pathway | Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; |
Function | RNA binding; |
◆ Recombinant Proteins | ||
SNRPF-2715H | Recombinant Human SNRPF Protein, His-tagged | +Inquiry |
SNRPF-4778C | Recombinant Chicken SNRPF | +Inquiry |
SNRPF-2851H | Recombinant Human SNRPF, His-tagged | +Inquiry |
SNRPF-8540M | Recombinant Mouse SNRPF Protein, His (Fc)-Avi-tagged | +Inquiry |
SNRPF-30585TH | Recombinant Human SNRPF, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNRPF-1612HCL | Recombinant Human SNRPF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNRPF Products
Required fields are marked with *
My Review for All SNRPF Products
Required fields are marked with *