Recombinant Human SNRPF, His-tagged
Cat.No. : | SNRPF-30585TH |
Product Overview : | Recombinant full length Human SNRPF (amino acids 1-86) with an N terminal His tag (106 amino acids with the tag); predicted mwt: 11.8 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 86 amino acids |
Description : | Small nuclear ribonucleoprotein polypeptide F, also known SNRPF, belongs to the snRNP Sm proteins family. There are at least seven isoforms, E, F, G, D1, D2, D3 and B/B. |
Conjugation : | HIS |
Molecular Weight : | 11.800kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVL YIRGVEEEEEDGEMRE |
Gene Name | SNRPF small nuclear ribonucleoprotein polypeptide F [ Homo sapiens ] |
Official Symbol | SNRPF |
Synonyms | SNRPF; small nuclear ribonucleoprotein polypeptide F; small nuclear ribonucleoprotein F; Sm F; |
Gene ID | 6636 |
mRNA Refseq | NM_003095 |
Protein Refseq | NP_003086 |
MIM | 603541 |
Uniprot ID | P62306 |
Chromosome Location | 12q23.1 |
Pathway | Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; |
Function | RNA binding; |
◆ Recombinant Proteins | ||
Snrpf-6008M | Recombinant Mouse Snrpf Protein, Myc/DDK-tagged | +Inquiry |
SNRPF-1820H | Recombinant Human SNRPF protein, GST-tagged | +Inquiry |
SNRPF-30585TH | Recombinant Human SNRPF, His-tagged | +Inquiry |
SNRPF-5371H | Recombinant Human SNRPF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SNRPF-8540M | Recombinant Mouse SNRPF Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNRPF-1612HCL | Recombinant Human SNRPF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNRPF Products
Required fields are marked with *
My Review for All SNRPF Products
Required fields are marked with *