Recombinant Human SNRPF, His-tagged

• Cat.No.: SNRPF-30585TH
• Product Overview: Recombinant full length Human SNRPF (amino acids 1-86) with an N terminal His tag (106 amino acids with the tag); predicted mwt: 11.8 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 86 amino acids
• Description: Small nuclear ribonucleoprotein polypeptide F, also known SNRPF, belongs to the snRNP Sm proteins family. There are at least seven isoforms, E, F, G, D1, D2, D3 and B/B.
• Conjugation: HIS
• Molecular Weight: 11.800kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVL YIRGVEEEEEDGEMRE

Gene Information

• Gene Name: SNRPF small nuclear ribonucleoprotein polypeptide F [ Homo sapiens ]
• Official Symbol: SNRPF
• Synonyms: SNRPF; small nuclear ribonucleoprotein polypeptide F; small nuclear ribonucleoprotein F; Sm F
• Gene ID: 6636
• mRNA Refseq: NM_003095
• Protein Refseq: NP_003086
• MIM: 603541
• Uniprot ID: P62306
• Chromosome Location: 12q23.1
• Pathway: Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem
• Function: RNA binding