Recombinant Human SNRPF, His-tagged
| Cat.No. : | SNRPF-30585TH |
| Product Overview : | Recombinant full length Human SNRPF (amino acids 1-86) with an N terminal His tag (106 amino acids with the tag); predicted mwt: 11.8 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 86 amino acids |
| Description : | Small nuclear ribonucleoprotein polypeptide F, also known SNRPF, belongs to the snRNP Sm proteins family. There are at least seven isoforms, E, F, G, D1, D2, D3 and B/B. |
| Conjugation : | HIS |
| Molecular Weight : | 11.800kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVL YIRGVEEEEEDGEMRE |
| Gene Name | SNRPF small nuclear ribonucleoprotein polypeptide F [ Homo sapiens ] |
| Official Symbol | SNRPF |
| Synonyms | SNRPF; small nuclear ribonucleoprotein polypeptide F; small nuclear ribonucleoprotein F; Sm F; |
| Gene ID | 6636 |
| mRNA Refseq | NM_003095 |
| Protein Refseq | NP_003086 |
| MIM | 603541 |
| Uniprot ID | P62306 |
| Chromosome Location | 12q23.1 |
| Pathway | Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; |
| Function | RNA binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNRPF Products
Required fields are marked with *
My Review for All SNRPF Products
Required fields are marked with *



