Recombinant Human SNRPF, His-tagged

Cat.No. : SNRPF-30585TH
Product Overview : Recombinant full length Human SNRPF (amino acids 1-86) with an N terminal His tag (106 amino acids with the tag); predicted mwt: 11.8 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 86 amino acids
Description : Small nuclear ribonucleoprotein polypeptide F, also known SNRPF, belongs to the snRNP Sm proteins family. There are at least seven isoforms, E, F, G, D1, D2, D3 and B/B.
Conjugation : HIS
Molecular Weight : 11.800kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVL YIRGVEEEEEDGEMRE
Gene Name SNRPF small nuclear ribonucleoprotein polypeptide F [ Homo sapiens ]
Official Symbol SNRPF
Synonyms SNRPF; small nuclear ribonucleoprotein polypeptide F; small nuclear ribonucleoprotein F; Sm F;
Gene ID 6636
mRNA Refseq NM_003095
Protein Refseq NP_003086
MIM 603541
Uniprot ID P62306
Chromosome Location 12q23.1
Pathway Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem;
Function RNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNRPF Products

Required fields are marked with *

My Review for All SNRPF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon