Recombinant Human SNRPF Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SNRPF-5371H
• Product Overview: SNRPF MS Standard C13 and N15-labeled recombinant protein (NP_003086) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: SNRPF (Small Nuclear Ribonucleoprotein Polypeptide F) is a Protein Coding gene. Among its related pathways are Transport of the SLBP independent Mature mRNA and mRNA Splicing - Minor Pathway. Gene Ontology (GO) annotations related to this gene include RNA binding. An important paralog of this gene is LSM6.
• Molecular Mass: 9.7 kDa
• AA Sequence: MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SNRPF small nuclear ribonucleoprotein polypeptide F [ Homo sapiens (human) ]
• Official Symbol: SNRPF
• Synonyms: SNRPF; small nuclear ribonucleoprotein polypeptide F; small nuclear ribonucleoprotein F; Sm F; sm protein F; SMF; Sm-F; snRNP-F
• Gene ID: 6636
• mRNA Refseq: NM_003095
• Protein Refseq: NP_003086
• MIM: 603541
• UniProt ID: P62306