Recombinant Human SNRPF Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SNRPF-5371H |
Product Overview : | SNRPF MS Standard C13 and N15-labeled recombinant protein (NP_003086) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | SNRPF (Small Nuclear Ribonucleoprotein Polypeptide F) is a Protein Coding gene. Among its related pathways are Transport of the SLBP independent Mature mRNA and mRNA Splicing - Minor Pathway. Gene Ontology (GO) annotations related to this gene include RNA binding. An important paralog of this gene is LSM6. |
Molecular Mass : | 9.7 kDa |
AA Sequence : | MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SNRPF small nuclear ribonucleoprotein polypeptide F [ Homo sapiens (human) ] |
Official Symbol | SNRPF |
Synonyms | SNRPF; small nuclear ribonucleoprotein polypeptide F; small nuclear ribonucleoprotein F; Sm F; sm protein F; SMF; Sm-F; snRNP-F; |
Gene ID | 6636 |
mRNA Refseq | NM_003095 |
Protein Refseq | NP_003086 |
MIM | 603541 |
UniProt ID | P62306 |
◆ Recombinant Proteins | ||
SNRPF-1168Z | Recombinant Zebrafish SNRPF | +Inquiry |
SNRPF-4778C | Recombinant Chicken SNRPF | +Inquiry |
SNRPF-1820H | Recombinant Human SNRPF protein, GST-tagged | +Inquiry |
SNRPF-3366H | Recombinant Human SNRPF, His-tagged | +Inquiry |
Snrpf-6008M | Recombinant Mouse Snrpf Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNRPF-1612HCL | Recombinant Human SNRPF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNRPF Products
Required fields are marked with *
My Review for All SNRPF Products
Required fields are marked with *