Recombinant Human SNUPN, His-tagged
| Cat.No. : | SNUPN-30607TH |
| Product Overview : | Recombinant full length Human SNURPORTIN1 with N-terminal His tag; 380aa, 43.3 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 360 amino acids |
| Description : | The nuclear import of the spliceosomal snRNPs U1, U2, U4 and U5, is dependent on the presence of a complex nuclear localization signal. The latter is composed of the 5-2,2,7-terminal trimethylguanosine (m3G) cap structure of the U snRNA and the Sm core domain. The protein encoded by this gene interacts specifically with m3G-cap and functions as an snRNP-specific nuclear import receptor. Alternatively spliced transcript variants encoding the same protein have been identified for this gene. |
| Conjugation : | HIS |
| Molecular Weight : | 43.300kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.24% Tris, 0.03% DTT, 0.58% Sodium chloride, 10% Glycerol |
| Storage : | Please see Notes section |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMEELSQALASSFSVSQDLNS TAAPHPRLSQYKSKYSSLEQSERRRRLLELQKSKRLDYVN HARRLAEDDWTGMESEEENKKDDEEMDIDTVKKLPKHYAN QLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTS AYTKSGYCVNRFSSLLPGGNRRNSTAKDYTILDCIYNEVN QTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGE KTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFY HKQTHYSPGSTPLVGWLRPYMVSDVLGVAVPAGPLTTKPD YAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYELEHLS TPKLKGSSHSPDHPGCLMEN |
| Sequence Similarities : | Belongs to the snurportin family.Contains 1 IBB domain. |
| Gene Name | SNUPN snurportin 1 [ Homo sapiens ] |
| Official Symbol | SNUPN |
| Synonyms | SNUPN; snurportin 1; RNA, U transporter 1 , RNUT1; snurportin-1; SNURPORTIN 1; Snurportin1; |
| Gene ID | 10073 |
| mRNA Refseq | NM_001042581 |
| Protein Refseq | NP_001036046 |
| MIM | 607902 |
| Uniprot ID | O95149 |
| Chromosome Location | 15q24.2 |
| Pathway | Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of non-coding RNA, organism-specific biosystem; RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; |
| Function | RNA cap binding; protein transporter activity; |
| ◆ Recombinant Proteins | ||
| SNUPN-30607TH | Recombinant Human SNUPN, His-tagged | +Inquiry |
| SNUPN-2746H | Recombinant Human Snurportin 1, His-tagged | +Inquiry |
| SNUPN-5084H | Recombinant Human SNUPN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Snupn-6018M | Recombinant Mouse Snupn Protein, Myc/DDK-tagged | +Inquiry |
| SNUPN-8545M | Recombinant Mouse SNUPN Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNUPN-1606HCL | Recombinant Human SNUPN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNUPN Products
Required fields are marked with *
My Review for All SNUPN Products
Required fields are marked with *
