Recombinant Human SNX24 protein, His-SUMO-tagged
| Cat.No. : | SNX24-3513H |
| Product Overview : | Recombinant Human SNX24 protein(Q9Y343)(1-169aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-169aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 35.8 kDa |
| AA Sequence : | MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLRDPYVLPAASDFPNVVIEGVLHGIFYPHLQPR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | SNX24 sorting nexin 24 [ Homo sapiens ] |
| Official Symbol | SNX24 |
| Synonyms | SNX24; sorting nexin 24; sorting nexin-24; SBBI31; sorting nexing 24; PRO1284; |
| Gene ID | 28966 |
| mRNA Refseq | NM_014035 |
| Protein Refseq | NP_054754 |
| UniProt ID | Q9Y343 |
| ◆ Recombinant Proteins | ||
| SNX24-4396R | Recombinant Rhesus monkey SNX24 Protein, His-tagged | +Inquiry |
| SNX24-4212R | Recombinant Rhesus Macaque SNX24 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SNX24-3412Z | Recombinant Zebrafish SNX24 | +Inquiry |
| SNX24-3513H | Recombinant Human SNX24 protein, His-SUMO-tagged | +Inquiry |
| SNX24-3736C | Recombinant Chicken SNX24 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SNX24-1592HCL | Recombinant Human SNX24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNX24 Products
Required fields are marked with *
My Review for All SNX24 Products
Required fields are marked with *
