Recombinant Human SNX24 protein, His-SUMO-tagged
Cat.No. : | SNX24-3513H |
Product Overview : | Recombinant Human SNX24 protein(Q9Y343)(1-169aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-169aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.8 kDa |
AA Sequence : | MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLRDPYVLPAASDFPNVVIEGVLHGIFYPHLQPR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SNX24 sorting nexin 24 [ Homo sapiens ] |
Official Symbol | SNX24 |
Synonyms | SNX24; sorting nexin 24; sorting nexin-24; SBBI31; sorting nexing 24; PRO1284; |
Gene ID | 28966 |
mRNA Refseq | NM_014035 |
Protein Refseq | NP_054754 |
UniProt ID | Q9Y343 |
◆ Recombinant Proteins | ||
SNX24-2863H | Recombinant Human SNX24, GST-tagged | +Inquiry |
SNX24-8551M | Recombinant Mouse SNX24 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNX24-15726M | Recombinant Mouse SNX24 Protein | +Inquiry |
SNX24-3736C | Recombinant Chicken SNX24 | +Inquiry |
SNX24-4212R | Recombinant Rhesus Macaque SNX24 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNX24-1592HCL | Recombinant Human SNX24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNX24 Products
Required fields are marked with *
My Review for All SNX24 Products
Required fields are marked with *