Recombinant Human SNX33 Protein, GST-tagged

Cat.No. : SNX33-4327H
Product Overview : Human MGC32065 partial ORF ( NP_695003, 475 a.a. - 574 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is involved in cytoskeletal reorganization, vesicle trafficking, endocytosis, and mitosis. The encoded protein is essential for the creation of the cleavage furrow during mitosis and for completion of mitosis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015]
Molecular Mass : 36.74 kDa
AA Sequence : YQGLLSNFPDIIHLQKGAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGFALQAEMNHFHQRRELDFKHMMQNYLRQQILFYQRVGQQLEKTLRMYDNL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SNX33 sorting nexin 33 [ Homo sapiens ]
Official Symbol SNX33
Synonyms SNX33; sorting nexin 33; SH3 and PX domain containing 3 , SH3PX3; sorting nexin-33; MGC32065; SH3PXD3C; SNX30; SH3 and PX domain containing 3; SH3 and PX domain-containing protein 3; SH3PX3;
Gene ID 257364
mRNA Refseq NM_153271
Protein Refseq NP_695003
UniProt ID Q8WV41

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNX33 Products

Required fields are marked with *

My Review for All SNX33 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon