Recombinant Human SNX5 protein, T7-tagged
Cat.No. : | SNX5-128H |
Product Overview : | Recombinant human SNX5 ( 404 aa ) fused with T7 tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 404 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGEFMAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQS PEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAV FKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFE QEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSS DEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEE LINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro SNX5 mediated cell receptor internalization regulation study by intracellular delivery of this protein with "ProFectin" reagent.2. May be used for mapping SNX5 protein – protein interaction assay.3. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.4. Potential biomarker protein for papillary thyroid carcinoma diagnosis.5. May be used for specific antibody production. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | SNX5 sorting nexin 5 [ Homo sapiens ] |
Official Symbol | SNX5 |
Synonyms | SNX5; sorting nexin 5; sorting nexin-5; FLJ10931; |
Gene ID | 27131 |
mRNA Refseq | NM_014426 |
Protein Refseq | NP_055241 |
MIM | 605937 |
UniProt ID | Q9Y5X3 |
Chromosome Location | 20p11 |
Pathway | Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; trans-Golgi Network Vesicle Budding, organism-specific biosystem; |
Function | lipid binding; phosphatidylinositol binding; phosphatidylinositol binding; |
◆ Recombinant Proteins | ||
SNX5-4215R | Recombinant Rhesus Macaque SNX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
SNX5-6635H | Recombinant Human SNX5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SNX5-1327C | Recombinant Chicken SNX5 | +Inquiry |
SNX5-128H | Recombinant Human SNX5 protein, T7-tagged | +Inquiry |
SNX5-4399R | Recombinant Rhesus monkey SNX5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNX5-1587HCL | Recombinant Human SNX5 293 Cell Lysate | +Inquiry |
SNX5-1588HCL | Recombinant Human SNX5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNX5 Products
Required fields are marked with *
My Review for All SNX5 Products
Required fields are marked with *