"SNX5" Related Products

Expand
Expand

Recombinant Human SNX5 protein, T7-tagged

Cat.No.: SNX5-128H
Product Overview: Recombinant human SNX5 ( 404 aa ) fused with T7 tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGEFMAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQS PEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAV FKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFE QEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSS DEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEE LINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro SNX5 mediated cell receptor internalization regulation study by intracellular delivery of this protein with "ProFectin" reagent.2. May be used for mapping SNX5 protein – protein interaction assay.3. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.4. Potential biomarker protein for papillary thyroid carcinoma diagnosis.5. May be used for specific antibody production.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: SNX5 sorting nexin 5 [ Homo sapiens ]
Official Symbol: SNX5
Synonyms: SNX5; sorting nexin 5; sorting nexin-5; FLJ10931;
Gene ID: 27131
mRNA Refseq: NM_014426
Protein Refseq: NP_055241
MIM: 605937
UniProt ID: Q9Y5X3
Chromosome Location: 20p11
Pathway: Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; trans-Golgi Network Vesicle Budding, organism-specific biosystem;
Function: lipid binding; phosphatidylinositol binding; phosphatidylinositol binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.