Recombinant Human SNX5 protein, T7-tagged

Cat.No. : SNX5-128H
Product Overview : Recombinant human SNX5 ( 404 aa ) fused with T7 tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 404 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGEFMAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQS PEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAV FKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFE QEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSS DEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEE LINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro SNX5 mediated cell receptor internalization regulation study by intracellular delivery of this protein with "ProFectin" reagent.2. May be used for mapping SNX5 protein – protein interaction assay.3. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.4. Potential biomarker protein for papillary thyroid carcinoma diagnosis.5. May be used for specific antibody production.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name SNX5 sorting nexin 5 [ Homo sapiens ]
Official Symbol SNX5
Synonyms SNX5; sorting nexin 5; sorting nexin-5; FLJ10931;
Gene ID 27131
mRNA Refseq NM_014426
Protein Refseq NP_055241
MIM 605937
UniProt ID Q9Y5X3
Chromosome Location 20p11
Pathway Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; trans-Golgi Network Vesicle Budding, organism-specific biosystem;
Function lipid binding; phosphatidylinositol binding; phosphatidylinositol binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNX5 Products

Required fields are marked with *

My Review for All SNX5 Products

Required fields are marked with *

0
cart-icon