Recombinant Human SOAT1
| Cat.No. : | SOAT1-31430TH |
| Product Overview : | Recombinant fragment of Human SOAT 1 with N terminal proprietary tag, predicted mwt: 33.66 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 73 amino acids |
| Description : | Acyl-coenzyme A:cholesterol acyltransferase (ACACT; EC 2.3.1.26) is an intracellular protein located in the endoplasmic reticulum that forms cholesterol esters from cholesterol. Accumulation of cholesterol esters as cytoplasmic lipid droplets within macrophages and smooth muscle cells is a characteristic feature of the early stages of atherosclerotic plaques (Cadigan et al. |
| Molecular Weight : | 33.660kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | PPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWG |
| Sequence Similarities : | Belongs to the membrane-bound acyltransferase family. Sterol o-acyltransferase subfamily. |
| Gene Name | SOAT1 sterol O-acyltransferase 1 [ Homo sapiens ] |
| Official Symbol | SOAT1 |
| Synonyms | SOAT1; sterol O-acyltransferase 1; SOAT, STAT, sterol O acyltransferase (acyl Coenzyme A: cholesterol acyltransferase) 1; ACAT; acyl Coenzyme A: cholesterol acyltransferase; |
| Gene ID | 6646 |
| mRNA Refseq | NM_003101 |
| Protein Refseq | NP_003092 |
| MIM | 102642 |
| Uniprot ID | P35610 |
| Chromosome Location | 1q25 |
| Pathway | Statin Pathway, organism-specific biosystem; Steroid biosynthesis, organism-specific biosystem; Steroid biosynthesis, conserved biosystem; |
| Function | cholesterol O-acyltransferase activity; cholesterol O-acyltransferase activity; cholesterol binding; fatty-acyl-CoA binding; sterol O-acyltransferase activity; |
| ◆ Recombinant Proteins | ||
| RFL1727MF | Recombinant Full Length Macaca Fascicularis Sterol O-Acyltransferase 1(Soat1) Protein, His-Tagged | +Inquiry |
| SOAT1-955C | Recombinant Cynomolgus SOAT1 Protein, His-tagged | +Inquiry |
| SOAT1-6662Z | Recombinant Zebrafish SOAT1 | +Inquiry |
| SOAT1-5319R | Recombinant Rat SOAT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SOAT1-698C | Recombinant Cynomolgus Monkey SOAT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SOAT1-1665HCL | Recombinant Human SOAT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOAT1 Products
Required fields are marked with *
My Review for All SOAT1 Products
Required fields are marked with *




