Recombinant Human SOAT1

Cat.No. : SOAT1-31430TH
Product Overview : Recombinant fragment of Human SOAT 1 with N terminal proprietary tag, predicted mwt: 33.66 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 73 amino acids
Description : Acyl-coenzyme A:cholesterol acyltransferase (ACACT; EC 2.3.1.26) is an intracellular protein located in the endoplasmic reticulum that forms cholesterol esters from cholesterol. Accumulation of cholesterol esters as cytoplasmic lipid droplets within macrophages and smooth muscle cells is a characteristic feature of the early stages of atherosclerotic plaques (Cadigan et al.
Molecular Weight : 33.660kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWG
Sequence Similarities : Belongs to the membrane-bound acyltransferase family. Sterol o-acyltransferase subfamily.
Gene Name SOAT1 sterol O-acyltransferase 1 [ Homo sapiens ]
Official Symbol SOAT1
Synonyms SOAT1; sterol O-acyltransferase 1; SOAT, STAT, sterol O acyltransferase (acyl Coenzyme A: cholesterol acyltransferase) 1; ACAT; acyl Coenzyme A: cholesterol acyltransferase;
Gene ID 6646
mRNA Refseq NM_003101
Protein Refseq NP_003092
MIM 102642
Uniprot ID P35610
Chromosome Location 1q25
Pathway Statin Pathway, organism-specific biosystem; Steroid biosynthesis, organism-specific biosystem; Steroid biosynthesis, conserved biosystem;
Function cholesterol O-acyltransferase activity; cholesterol O-acyltransferase activity; cholesterol binding; fatty-acyl-CoA binding; sterol O-acyltransferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SOAT1 Products

Required fields are marked with *

My Review for All SOAT1 Products

Required fields are marked with *

0
cart-icon
0
compare icon