Recombinant Human SOAT1
Cat.No. : | SOAT1-31430TH |
Product Overview : | Recombinant fragment of Human SOAT 1 with N terminal proprietary tag, predicted mwt: 33.66 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 73 amino acids |
Description : | Acyl-coenzyme A:cholesterol acyltransferase (ACACT; EC 2.3.1.26) is an intracellular protein located in the endoplasmic reticulum that forms cholesterol esters from cholesterol. Accumulation of cholesterol esters as cytoplasmic lipid droplets within macrophages and smooth muscle cells is a characteristic feature of the early stages of atherosclerotic plaques (Cadigan et al. |
Molecular Weight : | 33.660kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWG |
Sequence Similarities : | Belongs to the membrane-bound acyltransferase family. Sterol o-acyltransferase subfamily. |
Gene Name | SOAT1 sterol O-acyltransferase 1 [ Homo sapiens ] |
Official Symbol | SOAT1 |
Synonyms | SOAT1; sterol O-acyltransferase 1; SOAT, STAT, sterol O acyltransferase (acyl Coenzyme A: cholesterol acyltransferase) 1; ACAT; acyl Coenzyme A: cholesterol acyltransferase; |
Gene ID | 6646 |
mRNA Refseq | NM_003101 |
Protein Refseq | NP_003092 |
MIM | 102642 |
Uniprot ID | P35610 |
Chromosome Location | 1q25 |
Pathway | Statin Pathway, organism-specific biosystem; Steroid biosynthesis, organism-specific biosystem; Steroid biosynthesis, conserved biosystem; |
Function | cholesterol O-acyltransferase activity; cholesterol O-acyltransferase activity; cholesterol binding; fatty-acyl-CoA binding; sterol O-acyltransferase activity; |
◆ Recombinant Proteins | ||
SOAT1-2869H | Recombinant Human SOAT1 Protein, His-tagged | +Inquiry |
SOAT1-31430TH | Recombinant Human SOAT1 | +Inquiry |
SOAT1-6662Z | Recombinant Zebrafish SOAT1 | +Inquiry |
RFL8317HF | Recombinant Full Length Human Sterol O-Acyltransferase 1(Soat1) Protein, His-Tagged | +Inquiry |
SOAT1-2868H | Recombinant Human SOAT1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOAT1-1665HCL | Recombinant Human SOAT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOAT1 Products
Required fields are marked with *
My Review for All SOAT1 Products
Required fields are marked with *
0
Inquiry Basket