Recombinant Human SOAT1 Protein, His-tagged

Cat.No. : SOAT1-2869H
Product Overview : Recombinant Human SOAT1 Protein(1-140 aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-140 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AASequence : MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRT
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
Gene Name SOAT1 sterol O-acyltransferase 1 [ Homo sapiens ]
Official Symbol SOAT1
Synonyms SOAT1; sterol O-acyltransferase 1; SOAT, STAT, sterol O acyltransferase (acyl Coenzyme A: cholesterol acyltransferase) 1; ACAT; acyl Coenzyme A: cholesterol acyltransferase; acyl-coenzyme A:cholesterol acyltransferase 1; sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1; SOAT; STAT; ACACT; ACAT1; ACAT-1;
Gene ID 6646
mRNA Refseq NM_001252511
Protein Refseq NP_001239440
MIM 102642
UniProt ID P35610

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SOAT1 Products

Required fields are marked with *

My Review for All SOAT1 Products

Required fields are marked with *

0
cart-icon
0
compare icon