Recombinant Human SOAT1 Protein, His-tagged
Cat.No. : | SOAT1-2869H |
Product Overview : | Recombinant Human SOAT1 Protein(1-140 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-140 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AASequence : | MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRT |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
Gene Name | SOAT1 sterol O-acyltransferase 1 [ Homo sapiens ] |
Official Symbol | SOAT1 |
Synonyms | SOAT1; sterol O-acyltransferase 1; SOAT, STAT, sterol O acyltransferase (acyl Coenzyme A: cholesterol acyltransferase) 1; ACAT; acyl Coenzyme A: cholesterol acyltransferase; acyl-coenzyme A:cholesterol acyltransferase 1; sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1; SOAT; STAT; ACACT; ACAT1; ACAT-1; |
Gene ID | 6646 |
mRNA Refseq | NM_001252511 |
Protein Refseq | NP_001239440 |
MIM | 102642 |
UniProt ID | P35610 |
◆ Cell & Tissue Lysates | ||
SOAT1-1665HCL | Recombinant Human SOAT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOAT1 Products
Required fields are marked with *
My Review for All SOAT1 Products
Required fields are marked with *