Recombinant Human SOAT2 Protein, Trx-His-tagged
Cat.No. : | SOAT2-111H |
Product Overview : | Recombinant Human SOAT2 fused with N-terminall Trx-His was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Trx |
Description : | This gene is a member of a small family of acyl coenzyme A:cholesterol acyltransferases. The gene encodes a membrane-bound enzyme localized in the endoplasmic reticulum that produces intracellular cholesterol esters from long-chain fatty acyl CoA and cholesterol. The cholesterol esters are then stored as cytoplasmic lipid droplets inside the cell. The enzyme is implicated in cholesterol absorption in the intestine and in the assembly and secretion of apolipoprotein B-containing lipoproteins such as very low density lipoprotein (VLDL). Several alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. |
Form : | Supplied as a 0.2 µM filtered solution of PBS, pH 7.4 |
Molecular Mass : | 42kD |
AA Sequence : | MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSMNAGSDPVVIVSAARTIIGSFNGALAAVPVQDLGSTVIKEVLKRATVAPEDVSEVIFGHVLAAGCGQNPVRQASVGAGIPYSVPAWSCQM |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | SOAT2 sterol O-acyltransferase 2 [ Homo sapiens ] |
Official Symbol | SOAT2 |
Synonyms | SOAT2; sterol O-acyltransferase 2; ACAT2; ACAT-2; cholesterol acyltransferase 2; acyl-CoA:cholesterol acyltransferase 2; acyl Co-A: cholesterol acyltransferase 2; acyl coenzyme A:cholesterol acyltransferase 2; acyl-coenzyme A:cholesterol acyltransferase 2; ARGP2; ACACT2; MGC116732; |
Gene ID | 8435 |
mRNA Refseq | NM_003578 |
Protein Refseq | NP_003569 |
MIM | 601311 |
UniProt ID | O75908 |
◆ Recombinant Proteins | ||
SOAT2-2869H | Recombinant Human SOAT2, GST-tagged | +Inquiry |
SOAT2-5320R | Recombinant Rat SOAT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SOAT2-0252H | Recombinant Human SOAT2 Protein (Met1-Val397), N-His-tagged | +Inquiry |
SOAT2-2440H | Recombinant Human SOAT2 protein, His-tagged | +Inquiry |
SOAT2-8563M | Recombinant Mouse SOAT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOAT2-1583HCL | Recombinant Human SOAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOAT2 Products
Required fields are marked with *
My Review for All SOAT2 Products
Required fields are marked with *