Recombinant Human SOAT2 Protein, Trx-His-tagged

Cat.No. : SOAT2-111H
Product Overview : Recombinant Human SOAT2 fused with N-terminall Trx-His was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Trx
Description : This gene is a member of a small family of acyl coenzyme A:cholesterol acyltransferases. The gene encodes a membrane-bound enzyme localized in the endoplasmic reticulum that produces intracellular cholesterol esters from long-chain fatty acyl CoA and cholesterol. The cholesterol esters are then stored as cytoplasmic lipid droplets inside the cell. The enzyme is implicated in cholesterol absorption in the intestine and in the assembly and secretion of apolipoprotein B-containing lipoproteins such as very low density lipoprotein (VLDL). Several alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.
Form : Supplied as a 0.2 µM filtered solution of PBS, pH 7.4
Molecular Mass : 42kD
AA Sequence : MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSMNAGSDPVVIVSAARTIIGSFNGALAAVPVQDLGSTVIKEVLKRATVAPEDVSEVIFGHVLAAGCGQNPVRQASVGAGIPYSVPAWSCQM
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name SOAT2 sterol O-acyltransferase 2 [ Homo sapiens ]
Official Symbol SOAT2
Synonyms SOAT2; sterol O-acyltransferase 2; ACAT2; ACAT-2; cholesterol acyltransferase 2; acyl-CoA:cholesterol acyltransferase 2; acyl Co-A: cholesterol acyltransferase 2; acyl coenzyme A:cholesterol acyltransferase 2; acyl-coenzyme A:cholesterol acyltransferase 2; ARGP2; ACACT2; MGC116732;
Gene ID 8435
mRNA Refseq NM_003578
Protein Refseq NP_003569
MIM 601311
UniProt ID O75908

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SOAT2 Products

Required fields are marked with *

My Review for All SOAT2 Products

Required fields are marked with *

0
cart-icon
0
compare icon