Recombinant Human SORD, His-tagged
| Cat.No. : | SORD-30012TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 163-357 of Human Sorbitol Dehydrogenase with an N terminal His tag; Predicted MWt 22kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 163-357 a.a. |
| Description : | Sorbitol dehydrogenase (SORD; EC 1.1.1. |
| Conjugation : | HIS |
| Tissue specificity : | Expressed in kidney and epithelial cells of both benign and malignant prostate tissue. Expressed in epididymis (at protein level). |
| Form : | Lyophilised:Reconstitute with 77 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | HACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVV TDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQL GCKPEVTIECTGAEASIQAGIYATRSGGNLVLVGLGSE MTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSV NVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQN P |
| Sequence Similarities : | Belongs to the zinc-containing alcohol dehydrogenase family. |
| Gene Name | SORD sorbitol dehydrogenase [ Homo sapiens ] |
| Official Symbol | SORD |
| Synonyms | SORD; sorbitol dehydrogenase; |
| Gene ID | 6652 |
| mRNA Refseq | NM_003104 |
| Protein Refseq | NP_003095 |
| MIM | 182500 |
| Uniprot ID | Q00796 |
| Chromosome Location | 15q15-q21.1 |
| Pathway | Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
| Function | L-iditol 2-dehydrogenase activity; L-iditol 2-dehydrogenase activity; NAD binding; metal ion binding; oxidoreductase activity; |
| ◆ Recombinant Proteins | ||
| SORD-5389H | Recombinant Human SORD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Sord-6046M | Recombinant Mouse Sord Protein, Myc/DDK-tagged | +Inquiry |
| SORD-4408R | Recombinant Rhesus monkey SORD Protein, His-tagged | +Inquiry |
| SORD-01 | Active Recombinant Sorbitol Dehydrogenase Protein | +Inquiry |
| SORD-5544C | Recombinant Chicken SORD | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SORD-1569HCL | Recombinant Human SORD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SORD Products
Required fields are marked with *
My Review for All SORD Products
Required fields are marked with *
