Recombinant Human SORD, His-tagged
Cat.No. : | SORD-30012TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 163-357 of Human Sorbitol Dehydrogenase with an N terminal His tag; Predicted MWt 22kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 163-357 a.a. |
Description : | Sorbitol dehydrogenase (SORD; EC 1.1.1. |
Conjugation : | HIS |
Tissue specificity : | Expressed in kidney and epithelial cells of both benign and malignant prostate tissue. Expressed in epididymis (at protein level). |
Form : | Lyophilised:Reconstitute with 77 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | HACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVV TDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQL GCKPEVTIECTGAEASIQAGIYATRSGGNLVLVGLGSE MTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSV NVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQN P |
Sequence Similarities : | Belongs to the zinc-containing alcohol dehydrogenase family. |
Gene Name | SORD sorbitol dehydrogenase [ Homo sapiens ] |
Official Symbol | SORD |
Synonyms | SORD; sorbitol dehydrogenase; |
Gene ID | 6652 |
mRNA Refseq | NM_003104 |
Protein Refseq | NP_003095 |
MIM | 182500 |
Uniprot ID | Q00796 |
Chromosome Location | 15q15-q21.1 |
Pathway | Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
Function | L-iditol 2-dehydrogenase activity; L-iditol 2-dehydrogenase activity; NAD binding; metal ion binding; oxidoreductase activity; |
◆ Recombinant Proteins | ||
SORD-6335H | Recombinant Human SORD Protein (Ala98-Gln355), N-His tagged | +Inquiry |
SORD-5389H | Recombinant Human SORD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SORD-958C | Recombinant Cynomolgus SORD Protein, His-tagged | +Inquiry |
SORD-5330R | Recombinant Rat SORD Protein, His (Fc)-Avi-tagged | +Inquiry |
SORD-5671R | Recombinant Rat SORD Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SORD-1569HCL | Recombinant Human SORD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SORD Products
Required fields are marked with *
My Review for All SORD Products
Required fields are marked with *
0
Inquiry Basket