Recombinant Human SORD, His-tagged
Cat.No. : | SORD-30012TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 163-357 of Human Sorbitol Dehydrogenase with an N terminal His tag; Predicted MWt 22kDa. |
- Specification
- Gene Information
- Related Products
Description : | Sorbitol dehydrogenase (SORD; EC 1.1.1. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Expressed in kidney and epithelial cells of both benign and malignant prostate tissue. Expressed in epididymis (at protein level). |
Form : | Lyophilised:Reconstitute with 77 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | HACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVV TDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQL GCKPEVTIECTGAEASIQAGIYATRSGGNLVLVGLGSE MTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSV NVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQN P |
Sequence Similarities : | Belongs to the zinc-containing alcohol dehydrogenase family. |
Gene Name : | SORD sorbitol dehydrogenase [ Homo sapiens ] |
Official Symbol : | SORD |
Synonyms : | SORD; sorbitol dehydrogenase; |
Gene ID : | 6652 |
mRNA Refseq : | NM_003104 |
Protein Refseq : | NP_003095 |
MIM : | 182500 |
Uniprot ID : | Q00796 |
Chromosome Location : | 15q15-q21.1 |
Pathway : | Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
Function : | L-iditol 2-dehydrogenase activity; L-iditol 2-dehydrogenase activity; NAD binding; metal ion binding; oxidoreductase activity; |
Products Types
◆ Recombinant Protein | ||
SORD-8575M | Recombinant Mouse SORD Protein, His (Fc)-Avi-tagged | +Inquiry |
SORD-4224R | Recombinant Rhesus Macaque SORD Protein, His (Fc)-Avi-tagged | +Inquiry |
SORD-701C | Recombinant Cynomolgus Monkey SORD Protein, His (Fc)-Avi-tagged | +Inquiry |
SORD-5330R | Recombinant Rat SORD Protein, His (Fc)-Avi-tagged | +Inquiry |
Sord-6046M | Recombinant Mouse Sord Protein, Myc/DDK-tagged | +Inquiry |
◆ Lysates | ||
SORD-1569HCL | Recombinant Human SORD 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket