Recombinant Human SORD Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SORD-5389H |
Product Overview : | SORD MS Standard C13 and N15-labeled recombinant protein (NP_003095) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Sorbitol dehydrogenase (SORD; EC 1.1.1.14) catalyzes the interconversion of polyols and their corresponding ketoses, and together with aldose reductase (ALDR1), makes up the sorbitol pathway that is believed to play an important role in the development of diabetic complications. The first reaction of the pathway (also called the polyol pathway) is the reduction of glucose to sorbitol by ALDR1 with NADPH as the cofactor. SORD then oxidizes the sorbitol to fructose using NAD(+) cofactor. |
Molecular Mass : | 38.3 kDa |
AA Sequence : | MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SORD sorbitol dehydrogenase [ Homo sapiens (human) ] |
Official Symbol | SORD |
Synonyms | SORD; sorbitol dehydrogenase; L-iditol 2-dehydrogenase; SORD1; |
Gene ID | 6652 |
mRNA Refseq | NM_003104 |
Protein Refseq | NP_003095 |
MIM | 182500 |
UniProt ID | Q00796 |
◆ Recombinant Proteins | ||
SORD-01 | Active Recombinant Sorbitol Dehydrogenase Protein | +Inquiry |
SORD-5671R | Recombinant Rat SORD Protein | +Inquiry |
Sord-7045R | Recombinant Rat Sord protein, His & T7-tagged | +Inquiry |
SORD-29H | Active Recombinant Human SORD Protein | +Inquiry |
SORD-4224R | Recombinant Rhesus Macaque SORD Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SORD-1569HCL | Recombinant Human SORD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SORD Products
Required fields are marked with *
My Review for All SORD Products
Required fields are marked with *
0
Inquiry Basket