Recombinant Human SOWAHD Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: SOWAHD-136H
• Product Overview: ANKRD58 MS Standard C13 and N15-labeled recombinant protein (NP_001099046) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: SOWAHD (Sosondowah Ankyrin Repeat Domain Family Member D) is a Protein Coding gene. An important paralog of this gene is SOWAHA.
• Molecular Mass: 33.6 kDa
• AA Sequence: MAQLGGAANRAPTASLAPTSQSLRCAPQPRPSRADTGSLGRYWGKAAAAASREHPFPGTLMHSAAGSGRRRGALRELLGLQRAAPAGWLSEERAEELGGPSGPGSSRLCLEPREHAWILAAAEGRYEVLRELLEAEPELLLRGDPITGYSVLHWLAKHGRHEELILVHDFALRRGLRLDVSAPGSGGLTPLHLAALQGHDMVIKVLVGALGADATRRDHSGHRACHYLRPDAPWRLRELSGAEEWEMESGSGCTNLNNNSSGTTAWRAASAVGATAVETSRRVAASRTKAKDTAGSRVAQMHSLFRHLFPSFQDRSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SOWAHD sosondowah ankyrin repeat domain family member D [ Homo sapiens (human) ]
• Official Symbol: SOWAHD
• Synonyms: SOWAHD; sosondowah ankyrin repeat domain family member D; ANKRD58; ankyrin repeat domain-containing protein SOWAHD; ankyrin repeat domain 58; ankyrin repeat domain-containing protein 58; protein sosondowah homolog D
• Gene ID: 347454
• mRNA Refseq: NM_001105576
• Protein Refseq: NP_001099046
• UniProt ID: A6NJG2