Recombinant Human SOX10 protein(151-220 aa), C-His-tagged
| Cat.No. : | SOX10-2794H |
| Product Overview : | Recombinant Human SOX10 protein(P56693)(151-220 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 151-220 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | RPFIEEAERLRMQHKKDHPDYKYQPRRRKNGKAAQGEAECPGGEAEQGGTAAIQAHYKSAHLDHRHPGEG |
| Gene Name | SOX10 SRY (sex determining region Y)-box 10 [ Homo sapiens ] |
| Official Symbol | SOX10 |
| Synonyms | SOX10; SRY (sex determining region Y)-box 10; transcription factor SOX-10; DOM; dominant megacolon; mouse; human homolog of; WS2E; WS4; SRY-related HMG-box gene 10; dominant megacolon, mouse, human homolog of; PCWH; WS4C; MGC15649; |
| Gene ID | 6663 |
| mRNA Refseq | NM_006941 |
| Protein Refseq | NP_008872 |
| MIM | 602229 |
| UniProt ID | P56693 |
| ◆ Recombinant Proteins | ||
| SOX10-2794H | Recombinant Human SOX10 protein(151-220 aa), C-His-tagged | +Inquiry |
| SOX10-5675R | Recombinant Rat SOX10 Protein | +Inquiry |
| SOX10-9379Z | Recombinant Zebrafish SOX10 | +Inquiry |
| SOX10-15772M | Recombinant Mouse SOX10 Protein | +Inquiry |
| SOX10-1565H | Recombinant Human SOX10 protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SOX10-1565HCL | Recombinant Human SOX10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOX10 Products
Required fields are marked with *
My Review for All SOX10 Products
Required fields are marked with *
