Recombinant Human SOX10 Protein, GST-tagged
| Cat.No. : | SOX10-517H |
| Product Overview : | Human SOX10 full-length ORF ( NP_008872.1, 1 a.a. - 466 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffe |
| Molecular Mass : | 76.3 kDa |
| AA Sequence : | MAEEQDLSEVELSPVGSEEPRCLSPGSAPSLGPDGGGGGSGLRASPGPGELGKVKKEQQDGEADDDKFPVCIREAVSQVLSGYDWTLVPMPVRVNGASKSKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESDKRPFIEEAERLRMQHKKDHPDYKYQPRRRKNGKAAQGEAECPGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPTPPTTPKTELQSGKADPKRDGRSMGEGGKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP |
| Storage : | Store at -80 centigrade |
| Gene Name | SOX10 SRY-box 10 [ Homo sapiens (human) ] |
| Official Symbol | SOX10 |
| Synonyms | DOM,MGC15649,WS2E,WS4 |
| Gene ID | 6663 |
| mRNA Refseq | NM_006941.3 |
| Protein Refseq | NP_008872.1 |
| MIM | 277580 |
| UniProt ID | P56693 |
| ◆ Recombinant Proteins | ||
| SOX10-01H | Recombinant Human SOX10 Protein, Tag Free | +Inquiry |
| SOX10-29273TH | Recombinant Human SOX10 | +Inquiry |
| SOX10-6355C | Recombinant Chicken SOX10 | +Inquiry |
| SOX10-1565H | Recombinant Human SOX10 protein, MYC/DDK-tagged | +Inquiry |
| SOX10-1001HF | Recombinant Full Length Human SOX10 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SOX10-1565HCL | Recombinant Human SOX10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOX10 Products
Required fields are marked with *
My Review for All SOX10 Products
Required fields are marked with *
