Recombinant Human SOX10 Protein, GST-tagged
Cat.No. : | SOX10-517H |
Product Overview : | Human SOX10 full-length ORF ( NP_008872.1, 1 a.a. - 466 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffe |
Molecular Mass : | 76.3 kDa |
AA Sequence : | MAEEQDLSEVELSPVGSEEPRCLSPGSAPSLGPDGGGGGSGLRASPGPGELGKVKKEQQDGEADDDKFPVCIREAVSQVLSGYDWTLVPMPVRVNGASKSKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESDKRPFIEEAERLRMQHKKDHPDYKYQPRRRKNGKAAQGEAECPGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPTPPTTPKTELQSGKADPKRDGRSMGEGGKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP |
Storage : | Store at -80 centigrade |
Gene Name | SOX10 SRY-box 10 [ Homo sapiens (human) ] |
Official Symbol | SOX10 |
Synonyms | DOM,MGC15649,WS2E,WS4 |
Gene ID | 6663 |
mRNA Refseq | NM_006941.3 |
Protein Refseq | NP_008872.1 |
MIM | 277580 |
UniProt ID | P56693 |
◆ Recombinant Proteins | ||
SOX10-6355C | Recombinant Chicken SOX10 | +Inquiry |
SOX10-4783HFL | Recombinant Full Length Human SOX10 protein, Flag-tagged | +Inquiry |
SOX10-517H | Recombinant Human SOX10 Protein, GST-tagged | +Inquiry |
SOX10-1001HF | Recombinant Full Length Human SOX10 Protein, GST-tagged | +Inquiry |
SOX10-1565H | Recombinant Human SOX10 protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOX10-1565HCL | Recombinant Human SOX10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOX10 Products
Required fields are marked with *
My Review for All SOX10 Products
Required fields are marked with *