Recombinant Human SOX2 protein(11-90 aa), C-His-tagged
| Cat.No. : | SOX2-2771H |
| Product Overview : | Recombinant Human SOX2 protein(P48431)(11-90 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 11-90 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | PPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPF |
| Gene Name | SOX2 SRY (sex determining region Y)-box 2 [ Homo sapiens ] |
| Official Symbol | SOX2 |
| Synonyms | SOX2; SRY (sex determining region Y)-box 2; transcription factor SOX-2; transcription factor SOX2; SRY-related HMG-box gene 2; ANOP3; MCOPS3; MGC2413; |
| Gene ID | 6657 |
| mRNA Refseq | NM_003106 |
| Protein Refseq | NP_003097 |
| MIM | 184429 |
| UniProt ID | P48431 |
| ◆ Recombinant Proteins | ||
| SOX2-30150H | Recombinant Human SOX2 protein, GST-tagged | +Inquiry |
| SOX2-3962HFL | Recombinant Full Length Human SOX2 protein, Flag-tagged | +Inquiry |
| SOX2-12337Z | Recombinant Zebrafish SOX2 | +Inquiry |
| Sox2-6054M | Recombinant Mouse Sox2 Protein, Myc/DDK-tagged | +Inquiry |
| SOX2-15780M | Recombinant Mouse SOX2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SOX2-1561HCL | Recombinant Human SOX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOX2 Products
Required fields are marked with *
My Review for All SOX2 Products
Required fields are marked with *



