Recombinant Human SOX2 protein, GST-tagged
Cat.No. : | SOX2-30150H |
Product Overview : | Recombinant Human SOX2 (59-118 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met59-Thr118 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SOX2 SRY (sex determining region Y)-box 2 [ Homo sapiens ] |
Official Symbol | SOX2 |
Synonyms | SOX2; SRY (sex determining region Y)-box 2; transcription factor SOX-2; transcription factor SOX2; SRY-related HMG-box gene 2; ANOP3; MCOPS3; MGC2413; |
Gene ID | 6657 |
mRNA Refseq | NM_003106 |
Protein Refseq | NP_003097 |
MIM | 184429 |
UniProt ID | P48431 |
◆ Recombinant Proteins | ||
Sox2-6054M | Recombinant Mouse Sox2 Protein, Myc/DDK-tagged | +Inquiry |
Sox2-193M | Recombinant Mouse Sox2, His-tagged | +Inquiry |
SOX2-1274H | Recombinant Human SOX2 Protein (R40-D123), Tag Free | +Inquiry |
SOX2-8590M | Recombinant Mouse SOX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SOX2-3629H | Recombinant Human SOX2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOX2-1561HCL | Recombinant Human SOX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOX2 Products
Required fields are marked with *
My Review for All SOX2 Products
Required fields are marked with *