Recombinant Human SOX4 protein(91-170 aa), C-His-tagged
Cat.No. : | SOX4-2830H |
Product Overview : | Recombinant Human SOX4 protein(Q06945)(91-170 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 91-170 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | KRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKSGNANSSSSAAASSKPGEKGDKVGGSGGGGHGGGG |
Gene Name | SOX4 SRY (sex determining region Y)-box 4 [ Homo sapiens ] |
Official Symbol | SOX4 |
Synonyms | SOX4; SRY (sex determining region Y)-box 4; transcription factor SOX-4; SRY-related HMG-box gene 4; ecotropic viral integration site 16; EVI16; |
Gene ID | 6659 |
mRNA Refseq | NM_003107 |
Protein Refseq | NP_003098 |
MIM | 184430 |
UniProt ID | Q06945 |
◆ Recombinant Proteins | ||
SOX4-931H | Recombinant Human SOX4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Sox4-28M | Recombinant Mouse Sox4 protein, His-tagged | +Inquiry |
SOX4-15783M | Recombinant Mouse SOX4 Protein | +Inquiry |
SOX4-6054C | Recombinant Chicken SOX4 | +Inquiry |
SOX4-493HFL | Active Recombinant Full Length Human SOX4 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOX4-1559HCL | Recombinant Human SOX4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOX4 Products
Required fields are marked with *
My Review for All SOX4 Products
Required fields are marked with *