"SOX7" Related Products

Recombinant Human SOX7 protein, T7/His-tagged

Cat.No.: SOX7-173H
Product Overview: Recombinant human Sox7 cDNA (387 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFGSASLLGAYPWPEGLECPALDAELSDGQSPPAVPRPPGDKGSESRI RRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALTLSQKRPYVDEAERLRLQHMQDYPNYKYRPRRKK QAKRLCKRVDPGFLLSSLSRDQNALPEKRSGSRGALGEKEDRGEYSPGTALPSLRGCYHEGPAGGGGGGTPSSVD TYPYGLPTPPEMSPLDVLEPEQTFFSSPCQEEHGHPRRIPHLPGHPYSPEYAPSPLHCSHPLGSLALGQSPGVSM MSPVPGCPPSPAYYSPATYHPLHSNLQAHLGQLSPPPEHPGFDALDQLSQVELLGDMDRNEFDQYLNTPGHPDSA TGAMALSGHVPVSQVTPTGPTETSLISVLADATATYYNSYSVS
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: SOX7 SRY (sex determining region Y)-box 7 [ Homo sapiens ]
Official Symbol: SOX7
Synonyms: SOX7; SRY (sex determining region Y)-box 7; transcription factor SOX-7; SOX7 transcription factor; MGC10895;
Gene ID: 83595
mRNA Refseq: NM_031439
Protein Refseq: NP_113627
MIM: 612202
UniProt ID: Q9BT81
Chromosome Location: 8p22
Function: DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.