Recombinant Human SOX9 Protein, GST-tagged

• Cat.No.: SOX9-3045H
• Product Overview: Human SOX9 partial ORF ( NP_000337, 400 a.a. - 509 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal.
• Form: Liquid
• Molecular Mass: 37.84 kDa
• AA Sequence: EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SOX9 SRY (sex determining region Y)-box 9 [ Homo sapiens ]
• Official Symbol: SOX9
• Synonyms: SOX9; SRY (sex determining region Y)-box 9; campomelic dysplasia, autosomal sex reversal , CMD1, CMPD1; transcription factor SOX-9; SRA1; SRY-related HMG-box, gene 9; SRY (sex-determining region Y)-box 9 protein; CMD1; CMPD1
• Gene ID: 6662
• mRNA Refseq: NM_000346
• Protein Refseq: NP_000337
• MIM: 608160
• UniProt ID: P48436