"SOX9" Related Products

Expand
Expand

Recombinant Human SOX9 Protein, GST-tagged

Cat.No. : SOX9-3045H
Product Overview : Human SOX9 partial ORF ( NP_000337, 400 a.a. - 509 a.a.) recombinant protein with GST-tag at N-terminal.
Description : The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal.
Source : Wheat Germ
Species : Human
Tag : GST
Form : Liquid
Molecular Mass : 37.84 kDa
AA Sequence : EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : SOX9 SRY (sex determining region Y)-box 9 [ Homo sapiens ]
Official Symbol : SOX9
Synonyms : SOX9; SRY (sex determining region Y)-box 9; campomelic dysplasia, autosomal sex reversal , CMD1, CMPD1; transcription factor SOX-9; SRA1; SRY-related HMG-box, gene 9; SRY (sex-determining region Y)-box 9 protein; CMD1; CMPD1;
Gene ID : 6662
mRNA Refseq : NM_000346
Protein Refseq : NP_000337
MIM : 608160
UniProt ID : P48436

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.