Recombinant Human SOX9 Protein, GST-tagged
| Cat.No. : | SOX9-3045H |
| Product Overview : | Human SOX9 partial ORF ( NP_000337, 400 a.a. - 509 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. |
| Form : | Liquid |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | SOX9 SRY (sex determining region Y)-box 9 [ Homo sapiens ] |
| Official Symbol | SOX9 |
| Synonyms | SOX9; SRY (sex determining region Y)-box 9; campomelic dysplasia, autosomal sex reversal , CMD1, CMPD1; transcription factor SOX-9; SRA1; SRY-related HMG-box, gene 9; SRY (sex-determining region Y)-box 9 protein; CMD1; CMPD1; |
| Gene ID | 6662 |
| mRNA Refseq | NM_000346 |
| Protein Refseq | NP_000337 |
| MIM | 608160 |
| UniProt ID | P48436 |
| ◆ Recombinant Proteins | ||
| SOX9-5432H | Recombinant Human SOX9 protein(1-509aa), His-tagged | +Inquiry |
| Sox9-6060M | Recombinant Mouse Sox9 Protein, Myc/DDK-tagged | +Inquiry |
| SOX9-4232R | Recombinant Rhesus Macaque SOX9 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SOX9-2773H | Recombinant Human SOX9 protein(101-270 aa), C-His-tagged | +Inquiry |
| SOX9-5854C | Recombinant Chicken SOX9 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SOX9-1555HCL | Recombinant Human SOX9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOX9 Products
Required fields are marked with *
My Review for All SOX9 Products
Required fields are marked with *
