Cat.No. :	SOX9-3045H
Product Overview :	Human SOX9 partial ORF ( NP_000337, 400 a.a. - 509 a.a.) recombinant protein with GST-tag at N-terminal.
Description :	The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal.
Source :	Wheat Germ
Species :	Human
Tag :	GST
Form :	Liquid
Molecular Mass :	37.84 kDa
AA Sequence :	EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name :	SOX9 SRY (sex determining region Y)-box 9 [ Homo sapiens ]
Official Symbol :	SOX9
Synonyms :	SOX9; SRY (sex determining region Y)-box 9; campomelic dysplasia, autosomal sex reversal , CMD1, CMPD1; transcription factor SOX-9; SRA1; SRY-related HMG-box, gene 9; SRY (sex-determining region Y)-box 9 protein; CMD1; CMPD1;
Gene ID :	6662
mRNA Refseq :	NM_000346
Protein Refseq :	NP_000337
MIM :	608160
UniProt ID :	P48436

Online Inquiry