Recombinant Human SP100
Cat.No. : | SP100-30989TH |
Product Overview : | Recombinant fragment of Human SP100 with N terminal proprietary tag, 36.41kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 98 amino acids |
Description : | This gene encodes a subnuclear organelle and major component of the PML (promyelocytic leukemia)-SP100 nuclear bodies. PML and SP100 are covalently modified by the SUMO-1 modifier, which is considered crucial to nuclear body interactions. The encoded protein binds heterochromatin proteins and is thought to play a role in tumorigenesis, immunity, and gene regulation. Alternatively spliced variants have been identified for this gene; one of which encodes a high-mobility group protein. |
Molecular Weight : | 36.410kDa inclusive of tags |
Tissue specificity : | Widely expressed. Sp100-B is expressed only in spleen, tonsil, thymus, mature B-cell line and some T-cell line, but not in brain, liver, muscle or non-lymphoid cell lines. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRN |
Sequence Similarities : | Contains 2 HMG box DNA-binding domains.Contains 1 HSR domain.Contains 1 SAND domain. |
Gene Name | SP100 SP100 nuclear antigen [ Homo sapiens ] |
Official Symbol | SP100 |
Synonyms | SP100; SP100 nuclear antigen; nuclear antigen Sp100; nuclear autoantigen Sp-100; |
Gene ID | 6672 |
mRNA Refseq | NM_001080391 |
Protein Refseq | NP_001073860 |
MIM | 604585 |
Uniprot ID | P23497 |
Chromosome Location | 2q37.1 |
Pathway | Cytokine Signaling in Immune system, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem; |
Function | chromo shadow domain binding; identical protein binding; kinase binding; protein binding; protein domain specific binding; |
◆ Recombinant Proteins | ||
Sp100-464R | Recombinant Rat Sp100 Protein, His-tagged | +Inquiry |
SP100-201H | Recombinant Human SP100 Protein, GST-tagged | +Inquiry |
SP100-30989TH | Recombinant Human SP100 | +Inquiry |
SP100-202H | Recombinant Human SP100 Protein, His-tagged | +Inquiry |
SP100-105H | Recombinant Human SP100 nuclear antigen Protein, His&Flag&StrepII tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SP100-1674HCL | Recombinant Human SP100 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SP100 Products
Required fields are marked with *
My Review for All SP100 Products
Required fields are marked with *
0
Inquiry Basket