Recombinant Human SP100

• Cat.No.: SP100-30989TH
• Product Overview: Recombinant fragment of Human SP100 with N terminal proprietary tag, 36.41kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 98 amino acids
• Description: This gene encodes a subnuclear organelle and major component of the PML (promyelocytic leukemia)-SP100 nuclear bodies. PML and SP100 are covalently modified by the SUMO-1 modifier, which is considered crucial to nuclear body interactions. The encoded protein binds heterochromatin proteins and is thought to play a role in tumorigenesis, immunity, and gene regulation. Alternatively spliced variants have been identified for this gene; one of which encodes a high-mobility group protein.
• Molecular Weight: 36.410kDa inclusive of tags
• Tissue specificity: Widely expressed. Sp100-B is expressed only in spleen, tonsil, thymus, mature B-cell line and some T-cell line, but not in brain, liver, muscle or non-lymphoid cell lines.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRN
• Sequence Similarities: Contains 2 HMG box DNA-binding domains.Contains 1 HSR domain.Contains 1 SAND domain.

Gene Information

• Gene Name: SP100 SP100 nuclear antigen [ Homo sapiens ]
• Official Symbol: SP100
• Synonyms: SP100; SP100 nuclear antigen; nuclear antigen Sp100; nuclear autoantigen Sp-100
• Gene ID: 6672
• mRNA Refseq: NM_001080391
• Protein Refseq: NP_001073860
• MIM: 604585
• Uniprot ID: P23497
• Chromosome Location: 2q37.1
• Pathway: Cytokine Signaling in Immune system, organism-specific biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem
• Function: chromo shadow domain binding; identical protein binding; kinase binding; protein binding; protein domain specific binding