Recombinant Human SP6 protein, GST-tagged
Cat.No. : | SP6-30182H |
Product Overview : | Recombinant Human SP6 (1-235 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Glu235 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MLTAVCGSLGSQHTEAPHASPPRLDLQPLQTYQGHTSPEAGDYPSPLQPGELQSLPLGPEVDFSQGYELPGASSRVTCEDLESDSPLAPGPFSKLLQPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPHTQGALTSPGHPGALQAGLGGYVGDHQLCAPPPHPHAHHLLPAAGGQHLLGPPDGAKALEVAAPESQGLDSSLDGAARPKGSRRSVPRSSGQTVCRCPNCLE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SP6 Sp6 transcription factor [ Homo sapiens (human) ] |
Official Symbol | SP6 |
Synonyms | EPFN; KLF14; EPIPROFIN |
Gene ID | 80320 |
mRNA Refseq | NM_001258248 |
Protein Refseq | NP_001245177 |
MIM | 608613 |
UniProt ID | Q3SY56 |
◆ Recombinant Proteins | ||
SP6-30182H | Recombinant Human SP6 protein, GST-tagged | +Inquiry |
SP6-2889H | Recombinant Human SP6, His-tagged | +Inquiry |
Sp6-6063M | Recombinant Mouse Sp6 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SP6-1553HCL | Recombinant Human SP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SP6 Products
Required fields are marked with *
My Review for All SP6 Products
Required fields are marked with *