Recombinant Human SPACA3 protein, His-tagged
| Cat.No. : | SPACA3-2892H |
| Product Overview : | Recombinant Human SPACA3(20-123aa) protein was fused to His-tag and expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 104 |
| Description : | The protein encoded by this gene is a sperm surface protein that may be involved in adhesion to the egg prior to fertilization. While the encoded protein has significant similarity to lysozyme at the amino acid level, it has no detectable bacteriocidal activity. Several transcript variants encoding different isoforms have been found for this gene. |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5% trehalose and 5% mannitol are added as protectants before lyophilization. |
| Molecular Mass : | 17 kDa |
| AA Sequence : | PYAGVCLAYFTSGFNAAALDYEADGSTNNGIFQINSRRWCSNLTPNVPNVCRMYCSDLLNPNLKDTVICAMKITQEPQGLGYWEAWRHHCQGKDLTEWVDGCDF |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8 centigrade for (1-2 weeks). Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
| Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
| Gene Name | SPACA3 |
| Official Symbol | SPACA3 |
| Synonyms | CT54; LYC3; LYZC; LYZL3; SLLP1; ALLP17 |
| Gene ID | 124912 |
| mRNA Refseq | NM_173847.5 |
| Protein Refseq | NP_776246.1 |
| MIM | 612749 |
| UniProt ID | Q8IXA5 |
| ◆ Recombinant Proteins | ||
| SPACA3-527H | Recombinant Human SPACA3 protein, MYC/DDK-tagged | +Inquiry |
| SPACA3-2891H | Recombinant Human SPACA3, GST-tagged | +Inquiry |
| SPACA3-786H | Recombinant Hamadryas baboon SPACA3 protein, His&Myc-tagged | +Inquiry |
| SPACA3-579HF | Recombinant Full Length Human SPACA3 Protein, GST-tagged | +Inquiry |
| SPACA3-15803M | Recombinant Mouse SPACA3 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPACA3-1678HCL | Recombinant Human SPACA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPACA3 Products
Required fields are marked with *
My Review for All SPACA3 Products
Required fields are marked with *
