Recombinant Human SPANXN4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SPANXN4-2426H
Product Overview : SPANXN4 MS Standard C13 and N15-labeled recombinant protein (NP_001009613) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene represents one of several duplicated family members that are located on the X chromosome. This gene family encodes proteins that play a role in spermiogenesis. These proteins represent a specific subgroup of cancer/testis-associated antigens, and they may be candidates for tumor vaccines. This family member belongs to a subgroup of related genes that are present in all primates and rats and mice, and thus, it represents one of the ancestral family members.
Molecular Mass : 11.2 kDa
AA Sequence : MEEPTSSTNENKMKSPCESNKRKVDKKKKNLHRASAPEQSLKETEKAKYPTLVFYCRKNKKRNSNQLENNQPTESSTDPIKEKGDLDISAGSPQDGGQNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SPANXN4 SPANX family member N4 [ Homo sapiens (human) ]
Official Symbol SPANXN4
Synonyms SPANXN4; SPANX family member N4; CT11.9; sperm protein associated with the nucleus on the X chromosome N4; cancer/testis antigen family 11, member 9; nuclear-associated protein SPAN-Xn4
Gene ID 441525
mRNA Refseq NM_001009613
Protein Refseq NP_001009613
MIM 300667
UniProt ID Q5MJ08

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPANXN4 Products

Required fields are marked with *

My Review for All SPANXN4 Products

Required fields are marked with *

0
cart-icon
0
compare icon