Recombinant Human SPANXN4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SPANXN4-2426H
• Product Overview: SPANXN4 MS Standard C13 and N15-labeled recombinant protein (NP_001009613) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene represents one of several duplicated family members that are located on the X chromosome. This gene family encodes proteins that play a role in spermiogenesis. These proteins represent a specific subgroup of cancer/testis-associated antigens, and they may be candidates for tumor vaccines. This family member belongs to a subgroup of related genes that are present in all primates and rats and mice, and thus, it represents one of the ancestral family members.
• Molecular Mass: 11.2 kDa
• AA Sequence: MEEPTSSTNENKMKSPCESNKRKVDKKKKNLHRASAPEQSLKETEKAKYPTLVFYCRKNKKRNSNQLENNQPTESSTDPIKEKGDLDISAGSPQDGGQNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SPANXN4 SPANX family member N4 [ Homo sapiens (human) ]
• Official Symbol: SPANXN4
• Synonyms: SPANXN4; SPANX family member N4; CT11.9; sperm protein associated with the nucleus on the X chromosome N4; cancer/testis antigen family 11, member 9; nuclear-associated protein SPAN-Xn4
• Gene ID: 441525
• mRNA Refseq: NM_001009613
• Protein Refseq: NP_001009613
• MIM: 300667
• UniProt ID: Q5MJ08