Recombinant Human SPANXN4 protein, GST-tagged
Cat.No. : | SPANXN4-301186H |
Product Overview : | Recombinant Human SPANXN4 (22-99 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Arg22-Asn99 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | RKVDKKKKNLHRASAPEQSLKETEKAKYPTLVFYCRKNKKRNSNQLENNQPTESSTDPIKEKGDLDISAGSPQDGGQN |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SPANXN4 SPANX family member N4 [ Homo sapiens (human) ] |
Official Symbol | SPANXN4 |
Synonyms | CT11.9 |
Gene ID | 441525 |
mRNA Refseq | NM_001009613 |
Protein Refseq | NP_001009613 |
MIM | 300667 |
UniProt ID | Q5MJ08 |
◆ Recombinant Proteins | ||
SPANXN4-2576H | Recombinant Human SPANXN4 protein, His-tagged | +Inquiry |
SPANXN4-301186H | Recombinant Human SPANXN4 protein, GST-tagged | +Inquiry |
SPANXN4-4110H | Recombinant Human SPANXN4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPANXN4-2426H | Recombinant Human SPANXN4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SPANXN4-427H | Recombinant Human SPANXN4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPANXN4-1542HCL | Recombinant Human SPANXN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPANXN4 Products
Required fields are marked with *
My Review for All SPANXN4 Products
Required fields are marked with *