Recombinant Human SPAST protein, His-tagged
| Cat.No. : | SPAST-2537H |
| Product Overview : | Recombinant Human SPAST protein(79-278 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | December 14, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 79-278 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | CQRFSRALMAAKRSSGAAPAPASASAPAPVPGGEAERVRVFHKQAFEYISIALRIDEDEKAGQKEQAVEWYKKGIEELEKGIAVIVTGQGEQCERARRLQAKMMTNLVMAKDRLQLLESGAVPKRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQGSGPAPTTHKGTPKTNRTNKPSTPTTATRK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SPAST spastin [ Homo sapiens ] |
| Official Symbol | SPAST |
| Synonyms | SPAST; spastin; spastic paraplegia 4 (autosomal dominant; spastin) , SPG4; ADPSP; FSP2; KIAA1083; spastic paraplegia 4 protein; spastic paraplegia 4 (autosomal dominant; spastin); SPG4; |
| Gene ID | 6683 |
| mRNA Refseq | NM_014946 |
| Protein Refseq | NP_055761 |
| MIM | 604277 |
| UniProt ID | Q9UBP0 |
| ◆ Recombinant Proteins | ||
| SPAST-5344R | Recombinant Rat SPAST Protein, His (Fc)-Avi-tagged | +Inquiry |
| SPAST-369HFL | Recombinant Full Length Human SPAST Protein, C-Flag-tagged | +Inquiry |
| SPAST-5685R | Recombinant Rat SPAST Protein | +Inquiry |
| SPAST-8609M | Recombinant Mouse SPAST Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL18501DF | Recombinant Full Length Danio Rerio Spastin(Spast) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPAST Products
Required fields are marked with *
My Review for All SPAST Products
Required fields are marked with *
