Recombinant Human SPAST protein, His-tagged
Cat.No. : | SPAST-2537H |
Product Overview : | Recombinant Human SPAST protein(79-278 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 79-278 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | CQRFSRALMAAKRSSGAAPAPASASAPAPVPGGEAERVRVFHKQAFEYISIALRIDEDEKAGQKEQAVEWYKKGIEELEKGIAVIVTGQGEQCERARRLQAKMMTNLVMAKDRLQLLESGAVPKRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQGSGPAPTTHKGTPKTNRTNKPSTPTTATRK |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SPAST spastin [ Homo sapiens ] |
Official Symbol | SPAST |
Synonyms | SPAST; spastin; spastic paraplegia 4 (autosomal dominant; spastin) , SPG4; ADPSP; FSP2; KIAA1083; spastic paraplegia 4 protein; spastic paraplegia 4 (autosomal dominant; spastin); SPG4; |
Gene ID | 6683 |
mRNA Refseq | NM_014946 |
Protein Refseq | NP_055761 |
MIM | 604277 |
UniProt ID | Q9UBP0 |
◆ Recombinant Proteins | ||
RFL19823RF | Recombinant Full Length Rat Spastin(Spast) Protein, His-Tagged | +Inquiry |
RFL16855XF | Recombinant Full Length Xenopus Laevis Spastin(Spast) Protein, His-Tagged | +Inquiry |
SPAST-2416H | Recombinant Human SPAST Protein, MYC/DDK-tagged | +Inquiry |
RFL10255MF | Recombinant Full Length Mouse Spastin(Spast) Protein, His-Tagged | +Inquiry |
SPAST-15819M | Recombinant Mouse SPAST Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPAST Products
Required fields are marked with *
My Review for All SPAST Products
Required fields are marked with *
0
Inquiry Basket