Recombinant Human SPCS2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SPCS2-4411H
Product Overview : SPCS2 MS Standard C13 and N15-labeled recombinant protein (NP_055567) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.
Molecular Mass : 25 kDa
AA Sequence : MAAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISYFVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRTKQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLAIERKIKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SPCS2 signal peptidase complex subunit 2 [ Homo sapiens (human) ]
Official Symbol SPCS2
Synonyms SPCS2; signal peptidase complex subunit 2; signal peptidase complex subunit 2; SPase 25 kDa subunit; microsomal signal peptidase 25 kDa subunit; signal peptidase 25kDa subunit; signal peptidase complex subunit 2 homolog; EC 3.4.-.-
Gene ID 9789
mRNA Refseq NM_014752
Protein Refseq NP_055567
UniProt ID Q15005

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPCS2 Products

Required fields are marked with *

My Review for All SPCS2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon