Recombinant Human SPDEF Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SPDEF-643H |
Product Overview : | SPDEF MS Standard C13 and N15-labeled recombinant protein (NP_036523) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene belongs to the ETS family of transcription factors. It is highly expressed in the prostate epithelial cells, and functions as an androgen-independent transactivator of prostate-specific antigen (PSA) promoter. Higher expression of this protein has also been reported in brain, breast, lung and ovarian tumors, compared to the corresponding normal tissues, and it shows better tumor-association than other cancer-associated molecules, making it a more suitable target for developing specific cancer therapies. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 37.5 kDa |
AA Sequence : | MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SPDEF SAM pointed domain containing ets transcription factor [ Homo sapiens (human) ] |
Official Symbol | SPDEF |
Synonyms | SPDEF; SAM pointed domain containing ets transcription factor; SAM pointed domain-containing Ets transcription factor; bA375E1.3; PDEF; prostate-specific Ets; prostate-derived Ets factor; prostate epithelium-specific Ets transcription factor; RP11-375E1__A.3; |
Gene ID | 25803 |
mRNA Refseq | NM_012391 |
Protein Refseq | NP_036523 |
MIM | 608144 |
UniProt ID | O95238 |
◆ Recombinant Proteins | ||
SPDEF-643H | Recombinant Human SPDEF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SPDEF-1429HFL | Recombinant Full Length Human SPDEF Protein, C-Flag-tagged | +Inquiry |
Spdef-6088M | Recombinant Mouse Spdef Protein, Myc/DDK-tagged | +Inquiry |
SPDEF-2083H | Recombinant Human SPDEF Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPDEF-1524HCL | Recombinant Human SPDEF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPDEF Products
Required fields are marked with *
My Review for All SPDEF Products
Required fields are marked with *