Recombinant Human SPDEF Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SPDEF-643H
Product Overview : SPDEF MS Standard C13 and N15-labeled recombinant protein (NP_036523) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene belongs to the ETS family of transcription factors. It is highly expressed in the prostate epithelial cells, and functions as an androgen-independent transactivator of prostate-specific antigen (PSA) promoter. Higher expression of this protein has also been reported in brain, breast, lung and ovarian tumors, compared to the corresponding normal tissues, and it shows better tumor-association than other cancer-associated molecules, making it a more suitable target for developing specific cancer therapies. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 37.5 kDa
AA Sequence : MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SPDEF SAM pointed domain containing ets transcription factor [ Homo sapiens (human) ]
Official Symbol SPDEF
Synonyms SPDEF; SAM pointed domain containing ets transcription factor; SAM pointed domain-containing Ets transcription factor; bA375E1.3; PDEF; prostate-specific Ets; prostate-derived Ets factor; prostate epithelium-specific Ets transcription factor; RP11-375E1__A.3;
Gene ID 25803
mRNA Refseq NM_012391
Protein Refseq NP_036523
MIM 608144
UniProt ID O95238

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPDEF Products

Required fields are marked with *

My Review for All SPDEF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon