Recombinant Human SPG21 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SPG21-3706H
Product Overview : SPG21 MS Standard C13 and N15-labeled recombinant protein (NP_001121361) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene binds to the hydrophobic C-terminal amino acids of CD4 which are involved in repression of T cell activation. The interaction with CD4 is mediated by the noncatalytic alpha/beta hydrolase fold domain of this protein. It is thus proposed that this gene product modulates the stimulatory activity of CD4. Mutations in this gene are associated with autosomal recessive spastic paraplegia 21 (SPG21), also known as mast syndrome. Alternative splicing results in multiple transcript variants.
Molecular Mass : 35 kDa
AA Sequence : MGEIKVSPDYNWFRGTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFRQILALTGWGYRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNSFSDTSIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLTLNCQNSYVEPHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQEEQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SPG21 SPG21 abhydrolase domain containing, maspardin [ Homo sapiens (human) ]
Official Symbol SPG21
Synonyms SPG21; spastic paraplegia 21 (autosomal recessive, Mast syndrome); maspardin; ACP33; BM 019; GL010; MAST; acid cluster protein 33; spastic paraplegia 21 protein; spastic paraplegia 21 autosomal recessive Mast syndrome protein; BM-019; MASPARDIN;
Gene ID 51324
mRNA Refseq NM_001127889
Protein Refseq NP_001121361
MIM 608181
UniProt ID Q9NZD8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPG21 Products

Required fields are marked with *

My Review for All SPG21 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon