Recombinant Human SPG21 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SPG21-3706H |
Product Overview : | SPG21 MS Standard C13 and N15-labeled recombinant protein (NP_001121361) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene binds to the hydrophobic C-terminal amino acids of CD4 which are involved in repression of T cell activation. The interaction with CD4 is mediated by the noncatalytic alpha/beta hydrolase fold domain of this protein. It is thus proposed that this gene product modulates the stimulatory activity of CD4. Mutations in this gene are associated with autosomal recessive spastic paraplegia 21 (SPG21), also known as mast syndrome. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 35 kDa |
AA Sequence : | MGEIKVSPDYNWFRGTVPLKKIIVDDDDSKIWSLYDAGPRSIRCPLIFLPPVSGTADVFFRQILALTGWGYRVIALQYPVYWDHLEFCDGFRKLLDHLQLDKVHLFGASLGGFLAQKFAEYTHKSPRVHSLILCNSFSDTSIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLTLNCQNSYVEPHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQEEQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SPG21 SPG21 abhydrolase domain containing, maspardin [ Homo sapiens (human) ] |
Official Symbol | SPG21 |
Synonyms | SPG21; spastic paraplegia 21 (autosomal recessive, Mast syndrome); maspardin; ACP33; BM 019; GL010; MAST; acid cluster protein 33; spastic paraplegia 21 protein; spastic paraplegia 21 autosomal recessive Mast syndrome protein; BM-019; MASPARDIN; |
Gene ID | 51324 |
mRNA Refseq | NM_001127889 |
Protein Refseq | NP_001121361 |
MIM | 608181 |
UniProt ID | Q9NZD8 |
◆ Recombinant Proteins | ||
SPG21-3706H | Recombinant Human SPG21 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SPG21-4249R | Recombinant Rhesus Macaque SPG21 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPG21-30665TH | Recombinant Human SPG21, His-tagged | +Inquiry |
SPG21-5703R | Recombinant Rat SPG21 Protein | +Inquiry |
Spg21-6091M | Recombinant Mouse Spg21 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPG21-454MCL | Recombinant Mouse SPG21 cell lysate | +Inquiry |
SPG21-726HCL | Recombinant Human SPG21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPG21 Products
Required fields are marked with *
My Review for All SPG21 Products
Required fields are marked with *
0
Inquiry Basket