Recombinant Human SPINK1 protein, GST-tagged
Cat.No. : | SPINK1-1785H |
Product Overview : | Recombinant Human SPINK1 protein(24-79 aa), fused to GST tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 24-79 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SPINK1 serine peptidase inhibitor, Kazal type 1 [ Homo sapiens ] |
Official Symbol | SPINK1 |
Synonyms | SPINK1; serine peptidase inhibitor, Kazal type 1; serine protease inhibitor, Kazal type 1; pancreatic secretory trypsin inhibitor; PCTT; PSTI; Spink3; TATI; tumor-associated trypsin inhibitor; serine protease inhibitor Kazal-type 1; TCP; |
Gene ID | 6690 |
mRNA Refseq | NM_003122 |
Protein Refseq | NP_003113 |
MIM | 167790 |
UniProt ID | P00995 |
◆ Recombinant Proteins | ||
SPINK1-6345H | Recombinant Human SPINK1 Protein (Asp24-Cys79), C-His tagged | +Inquiry |
SPINK1-6346H | Recombinant Human SPINK1 Protein (Asp24-Cys79), N-GST tagged | +Inquiry |
SPINK1-6344H | Recombinant Human SPINK1 Protein (Met1-Cys79), C-His tagged | +Inquiry |
SPINK1-5710R | Recombinant Rat SPINK1 Protein | +Inquiry |
SPINK1-1785H | Recombinant Human SPINK1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPINK1-1511HCL | Recombinant Human SPINK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPINK1 Products
Required fields are marked with *
My Review for All SPINK1 Products
Required fields are marked with *
0
Inquiry Basket