Recombinant Human SPINK7 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SPINK7-4012H
Product Overview : SPINK7 MS Standard C13 and N15-labeled recombinant protein (NP_115955) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Probable serine protease inhibitor.
Molecular Mass : 9.2 kDa
AA Sequence : MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SPINK7 serine peptidase inhibitor Kazal type 7 [ Homo sapiens (human) ]
Official Symbol SPINK7
Synonyms SPINK;7 serine peptidase inhibitor, Kazal type 7 (putative); ECG2; ECRG2; serine protease inhibitor Kazal-type 7; ECRG-2; esophagus cancer-related gene 2 protein; esophagus cancer-related gene-2; serine peptidase inhibitor, Kazal type 7 (putative)
Gene ID 84651
mRNA Refseq NM_032566
Protein Refseq NP_115955
MIM 617288
UniProt ID P58062

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPINK7 Products

Required fields are marked with *

My Review for All SPINK7 Products

Required fields are marked with *

0
cart-icon
0
compare icon