Recombinant Human SPINK7 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SPINK7-4012H |
| Product Overview : | SPINK7 MS Standard C13 and N15-labeled recombinant protein (NP_115955) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Probable serine protease inhibitor. |
| Molecular Mass : | 9.2 kDa |
| AA Sequence : | MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SPINK7 serine peptidase inhibitor Kazal type 7 [ Homo sapiens (human) ] |
| Official Symbol | SPINK7 |
| Synonyms | SPINK;7 serine peptidase inhibitor, Kazal type 7 (putative); ECG2; ECRG2; serine protease inhibitor Kazal-type 7; ECRG-2; esophagus cancer-related gene 2 protein; esophagus cancer-related gene-2; serine peptidase inhibitor, Kazal type 7 (putative) |
| Gene ID | 84651 |
| mRNA Refseq | NM_032566 |
| Protein Refseq | NP_115955 |
| MIM | 617288 |
| UniProt ID | P58062 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPINK7 Products
Required fields are marked with *
My Review for All SPINK7 Products
Required fields are marked with *



