Recombinant Human SPINK7 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SPINK7-4012H |
Product Overview : | SPINK7 MS Standard C13 and N15-labeled recombinant protein (NP_115955) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Probable serine protease inhibitor. |
Molecular Mass : | 9.2 kDa |
AA Sequence : | MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SPINK7 serine peptidase inhibitor Kazal type 7 [ Homo sapiens (human) ] |
Official Symbol | SPINK7 |
Synonyms | SPINK;7 serine peptidase inhibitor, Kazal type 7 (putative); ECG2; ECRG2; serine protease inhibitor Kazal-type 7; ECRG-2; esophagus cancer-related gene 2 protein; esophagus cancer-related gene-2; serine peptidase inhibitor, Kazal type 7 (putative) |
Gene ID | 84651 |
mRNA Refseq | NM_032566 |
Protein Refseq | NP_115955 |
MIM | 617288 |
UniProt ID | P58062 |
◆ Recombinant Proteins | ||
SPINK7-0331C | Recombinant Chicken SPINK7 Protein (Ala25-Cys210), N-His-tagged | +Inquiry |
SPINK7-6633H | Recombinant Human SPINK7 Protein (Ser20-Cys85), C-His tagged | +Inquiry |
Spink7-6097M | Recombinant Mouse Spink7 Protein, Myc/DDK-tagged | +Inquiry |
SPINK7-4746HF | Recombinant Full Length Human SPINK7 Protein, GST-tagged | +Inquiry |
SPINK7-4012H | Recombinant Human SPINK7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPINK7-1509HCL | Recombinant Human SPINK7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPINK7 Products
Required fields are marked with *
My Review for All SPINK7 Products
Required fields are marked with *