Recombinant Human SPINK9 protein, His-tagged

• Cat.No.: SPINK9-4616H
• Product Overview: Recombinant Human SPINK9 protein(Q5DT21)(20-86 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 20-86 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 14.6 kDa
• AASequence: IECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGKC
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: SPINK9 serine peptidase inhibitor, Kazal type 9 [ Homo sapiens ]
• Official Symbol: SPINK9
• Synonyms: LEKTI2
• Gene ID: 643394
• mRNA Refseq: NM_001040433.1
• Protein Refseq: NP_001035523.1
• MIM: 613511
• UniProt ID: Q5DT21