Recombinant Human SPO11 protein, His-tagged
Cat.No. : | SPO11-3533H |
Product Overview : | Recombinant Human SPO11 protein(Q9Y5K1)(1-396aa), fused with C-terminal His tag, was expressed in Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect cells |
Tag : | His |
Protein Length : | 1-396aa |
Tag : | C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MAFAPMGPEASFFDVLDRHRESLLAALRRGGREPPTGGSRLASSSEVLASIENIIQDIITSLARNEAPAFTIDNRSSWENIKFEDSVGLQMVSHCTTRKIKSDSPKSAQKFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNIQGIRNLVTDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPDLNTRLLVKKLWDTFHVPVFTLVDADPHGIEIMCIYKYGSMSMSFEAHHLTVPAIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKLKFGGWI |
Gene Name | SPO11 SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | SPO11 |
Synonyms | SPO11; SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae); SPO11 meiotic protein covalently bound to DSB like (S. cerevisiae) , SPO11, meiotic protein covalently bound to DSB (S. cerevisiae) like; meiotic recombination protein SPO11; cancer/testis antigen 35; CT35; MGC39953; |
Gene ID | 23626 |
mRNA Refseq | NM_012444 |
Protein Refseq | NP_036576 |
MIM | 605114 |
UniProt ID | Q9Y5K1 |
◆ Recombinant Proteins | ||
SPO11-5211H | Recombinant Human SPO11 protein, His-tagged | +Inquiry |
SPO11-3533H | Recombinant Human SPO11 protein, His-tagged | +Inquiry |
SPO11-11705Z | Recombinant Zebrafish SPO11 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPO11-1684HCL | Recombinant Human SPO11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPO11 Products
Required fields are marked with *
My Review for All SPO11 Products
Required fields are marked with *
0
Inquiry Basket