Recombinant Human SPO11 protein, His-tagged
| Cat.No. : | SPO11-3533H |
| Product Overview : | Recombinant Human SPO11 protein(Q9Y5K1)(1-396aa), fused with C-terminal His tag, was expressed in Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect cells |
| Tag : | His |
| Protein Length : | 1-396aa |
| Tag : | C-His |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 47.3 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MAFAPMGPEASFFDVLDRHRESLLAALRRGGREPPTGGSRLASSSEVLASIENIIQDIITSLARNEAPAFTIDNRSSWENIKFEDSVGLQMVSHCTTRKIKSDSPKSAQKFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNIQGIRNLVTDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPDLNTRLLVKKLWDTFHVPVFTLVDADPHGIEIMCIYKYGSMSMSFEAHHLTVPAIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTCQPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKLKFGGWI |
| Gene Name | SPO11 SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | SPO11 |
| Synonyms | SPO11; SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae); SPO11 meiotic protein covalently bound to DSB like (S. cerevisiae) , SPO11, meiotic protein covalently bound to DSB (S. cerevisiae) like; meiotic recombination protein SPO11; cancer/testis antigen 35; CT35; MGC39953; |
| Gene ID | 23626 |
| mRNA Refseq | NM_012444 |
| Protein Refseq | NP_036576 |
| MIM | 605114 |
| UniProt ID | Q9Y5K1 |
| ◆ Recombinant Proteins | ||
| SPO11-5211H | Recombinant Human SPO11 protein, His-tagged | +Inquiry |
| SPO11-11705Z | Recombinant Zebrafish SPO11 | +Inquiry |
| SPO11-3533H | Recombinant Human SPO11 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPO11-1684HCL | Recombinant Human SPO11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPO11 Products
Required fields are marked with *
My Review for All SPO11 Products
Required fields are marked with *
