Recombinant Human SPON2 protein, T7/His-tagged
Cat.No. : | SPON2-197H |
Product Overview : | Recombinant human SPON2 cDNA (27–331aa, derived from BC036341) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 27-331 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFQPLGGESICSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSL LGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSVHAVFSAPAVPSGTGQTSAELEVQRRHS LVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPA NSFYYPRLKALPPIARVTLVRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGHCGRLG TKSRTRYVRVQPANNGSPCPELEEEAECVPDNCV |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | SPON2 spondin 2, extracellular matrix protein [ Homo sapiens ] |
Official Symbol | SPON2 |
Synonyms | SPON2; spondin-2; DIL1; M spondin; Mindin; DIL-1; MINDIN; M-SPONDIN; FLJ16313; FLJ22401; FLJ34460; DKFZp686G21139; |
Gene ID | 10417 |
mRNA Refseq | NM_001128325 |
Protein Refseq | NP_001121797 |
MIM | 605918 |
UniProt ID | Q9BUD6 |
Chromosome Location | 4p16.3 |
Function | metal ion binding; receptor binding; |
◆ Recombinant Proteins | ||
SPON2-15919M | Recombinant Mouse SPON2 Protein | +Inquiry |
SPON2-2928H | Recombinant Human SPON2, His-tagged | +Inquiry |
Spon2-214R | Recombinant Rat Spon2 Protein, His-tagged | +Inquiry |
SPON2-212H | Recombinant Human SPON2 Protein, His/GST-tagged | +Inquiry |
SPON2-197H | Recombinant Human SPON2 protein, T7/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPON2-1503HCL | Recombinant Human SPON2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPON2 Products
Required fields are marked with *
My Review for All SPON2 Products
Required fields are marked with *